Basic Information | |
---|---|
Family ID | F004898 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 419 |
Average Sequence Length | 42 residues |
Representative Sequence | MDLSELIDELREIAIYETDPQDWMGYLENDDYWVPDTELAY |
Number of Associated Samples | 200 |
Number of Associated Scaffolds | 419 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Viruses |
% of genes with valid RBS motifs | 74.26 % |
% of genes near scaffold ends (potentially truncated) | 25.78 % |
% of genes from short scaffolds (< 2000 bps) | 69.93 % |
Associated GOLD sequencing projects | 171 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.34 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Predicted Viral (42.482 % of family members) |
NCBI Taxonomy ID | 10239 (predicted) |
Taxonomy | All Organisms → Viruses → Predicted Viral |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous (18.377 % of family members) |
Environment Ontology (ENVO) | Unclassified (30.072 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Saline → Water (saline) (58.473 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Globular | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 28.99% β-sheet: 0.00% Coil/Unstructured: 71.01% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.34 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 419 Family Scaffolds |
---|---|---|
PF02672 | CP12 | 11.93 |
PF01555 | N6_N4_Mtase | 11.69 |
PF02086 | MethyltransfD12 | 2.39 |
PF07460 | NUMOD3 | 2.15 |
PF13640 | 2OG-FeII_Oxy_3 | 1.67 |
PF03330 | DPBB_1 | 1.19 |
PF07669 | Eco57I | 0.95 |
PF05118 | Asp_Arg_Hydrox | 0.95 |
PF05869 | Dam | 0.48 |
PF02511 | Thy1 | 0.24 |
PF04851 | ResIII | 0.24 |
PF02384 | N6_Mtase | 0.24 |
PF00386 | C1q | 0.24 |
PF04820 | Trp_halogenase | 0.24 |
PF13759 | 2OG-FeII_Oxy_5 | 0.24 |
PF03104 | DNA_pol_B_exo1 | 0.24 |
PF02801 | Ketoacyl-synt_C | 0.24 |
PF16075 | DUF4815 | 0.24 |
PF11649 | T4_neck-protein | 0.24 |
PF07230 | Portal_Gp20 | 0.24 |
PF05996 | Fe_bilin_red | 0.24 |
PF02963 | EcoRI | 0.24 |
PF13544 | Obsolete Pfam Family | 0.24 |
PF06044 | DpnI | 0.24 |
PF01844 | HNH | 0.24 |
COG ID | Name | Functional Category | % Frequency in 419 Family Scaffolds |
---|---|---|---|
COG0863 | DNA modification methylase | Replication, recombination and repair [L] | 11.69 |
COG1041 | tRNA G10 N-methylase Trm11 | Translation, ribosomal structure and biogenesis [J] | 11.69 |
COG2189 | Adenine specific DNA methylase Mod | Replication, recombination and repair [L] | 11.69 |
COG0338 | DNA-adenine methylase | Replication, recombination and repair [L] | 2.39 |
COG3392 | Adenine-specific DNA methylase | Replication, recombination and repair [L] | 2.39 |
COG3555 | Aspartyl/asparaginyl beta-hydroxylase, cupin superfamily | Posttranslational modification, protein turnover, chaperones [O] | 0.95 |
COG0417 | DNA polymerase B elongation subunit | Replication, recombination and repair [L] | 0.24 |
COG1351 | Thymidylate synthase ThyX, FAD-dependent family | Nucleotide transport and metabolism [F] | 0.24 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 61.58 % |
Unclassified | root | N/A | 38.42 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
3300000116|DelMOSpr2010_c10083279 | All Organisms → Viruses → Predicted Viral | 1259 | Open in IMG/M |
3300000116|DelMOSpr2010_c10085072 | All Organisms → Viruses → Predicted Viral | 1239 | Open in IMG/M |
3300000116|DelMOSpr2010_c10160709 | Not Available | 758 | Open in IMG/M |
3300001213|JGIcombinedJ13530_107758406 | Not Available | 500 | Open in IMG/M |
3300001255|B570J13889_100553 | All Organisms → Viruses | 916 | Open in IMG/M |
3300001818|ACM19_102034 | All Organisms → Viruses → Predicted Viral | 1275 | Open in IMG/M |
3300001824|ACM36_111144 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 511 | Open in IMG/M |
3300001826|ACM20_113362 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 666 | Open in IMG/M |
3300001827|ACM21_1024039 | All Organisms → Viruses → Predicted Viral | 1891 | Open in IMG/M |
3300001828|ACM3_1001595 | All Organisms → Viruses → Predicted Viral | 3005 | Open in IMG/M |
3300001830|ACM40_1014656 | Not Available | 602 | Open in IMG/M |
3300001955|GOS2237_1050127 | Not Available | 922 | Open in IMG/M |
3300001968|GOS2236_1035685 | All Organisms → Viruses → Predicted Viral | 1931 | Open in IMG/M |
3300001968|GOS2236_1035756 | All Organisms → Viruses → Predicted Viral | 1573 | Open in IMG/M |
3300001968|GOS2236_1058385 | All Organisms → Viruses → Predicted Viral | 3677 | Open in IMG/M |
3300001968|GOS2236_1066319 | All Organisms → Viruses → Predicted Viral | 3019 | Open in IMG/M |
3300001968|GOS2236_1069735 | All Organisms → Viruses → Predicted Viral | 1627 | Open in IMG/M |
3300001968|GOS2236_1090019 | All Organisms → Viruses → Predicted Viral | 2415 | Open in IMG/M |
3300002835|B570J40625_100015342 | Not Available | 13430 | Open in IMG/M |
3300004240|Ga0007787_10065930 | All Organisms → Viruses → Predicted Viral | 1644 | Open in IMG/M |
3300004240|Ga0007787_10185025 | All Organisms → Viruses → Predicted Viral | 1011 | Open in IMG/M |
3300004481|Ga0069718_11210499 | All Organisms → Viruses → Predicted Viral | 1113 | Open in IMG/M |
3300004481|Ga0069718_15632355 | All Organisms → Viruses → Predicted Viral | 4816 | Open in IMG/M |
3300005527|Ga0068876_10000498 | Not Available | 32138 | Open in IMG/M |
3300005527|Ga0068876_10004546 | Not Available | 9745 | Open in IMG/M |
3300005527|Ga0068876_10029502 | All Organisms → Viruses → Predicted Viral | 3422 | Open in IMG/M |
3300005527|Ga0068876_10110408 | All Organisms → Viruses → Predicted Viral | 1636 | Open in IMG/M |
3300005527|Ga0068876_10180138 | All Organisms → Viruses → Predicted Viral | 1232 | Open in IMG/M |
3300005527|Ga0068876_10236562 | All Organisms → Viruses → Predicted Viral | 1051 | Open in IMG/M |
3300005581|Ga0049081_10041230 | All Organisms → Viruses → Predicted Viral | 1753 | Open in IMG/M |
3300005662|Ga0078894_10093859 | All Organisms → Viruses → Predicted Viral | 2638 | Open in IMG/M |
3300005739|Ga0076948_1036090 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 14046 | Open in IMG/M |
3300005805|Ga0079957_1000060 | Not Available | 78856 | Open in IMG/M |
3300005805|Ga0079957_1003140 | Not Available | 14189 | Open in IMG/M |
3300005805|Ga0079957_1093253 | All Organisms → Viruses → Predicted Viral | 1663 | Open in IMG/M |
3300005805|Ga0079957_1177246 | All Organisms → Viruses → Predicted Viral | 1053 | Open in IMG/M |
3300005805|Ga0079957_1263776 | Not Available | 793 | Open in IMG/M |
3300005934|Ga0066377_10001693 | Not Available | 5133 | Open in IMG/M |
3300005934|Ga0066377_10178063 | Not Available | 651 | Open in IMG/M |
3300005934|Ga0066377_10190935 | Not Available | 628 | Open in IMG/M |
3300005940|Ga0073913_10001391 | All Organisms → Viruses → Predicted Viral | 3470 | Open in IMG/M |
3300005940|Ga0073913_10002225 | All Organisms → Viruses → Predicted Viral | 2623 | Open in IMG/M |
3300005940|Ga0073913_10004072 | All Organisms → Viruses → Predicted Viral | 1929 | Open in IMG/M |
3300005943|Ga0073926_10094752 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → Greenvirus | 606 | Open in IMG/M |
3300006025|Ga0075474_10167524 | Not Available | 684 | Open in IMG/M |
3300006025|Ga0075474_10200313 | Not Available | 612 | Open in IMG/M |
3300006026|Ga0075478_10046137 | All Organisms → Viruses → Predicted Viral | 1434 | Open in IMG/M |
3300006030|Ga0075470_10001560 | All Organisms → Viruses | 7157 | Open in IMG/M |
3300006637|Ga0075461_10042058 | All Organisms → Viruses → Predicted Viral | 1491 | Open in IMG/M |
3300006637|Ga0075461_10046521 | All Organisms → Viruses → Predicted Viral | 1412 | Open in IMG/M |
3300006639|Ga0079301_1070605 | All Organisms → Viruses → Predicted Viral | 1100 | Open in IMG/M |
3300006802|Ga0070749_10633297 | Not Available | 575 | Open in IMG/M |
3300006802|Ga0070749_10724645 | Not Available | 531 | Open in IMG/M |
3300006810|Ga0070754_10198244 | All Organisms → Viruses | 937 | Open in IMG/M |
3300006810|Ga0070754_10250158 | Not Available | 809 | Open in IMG/M |
3300006810|Ga0070754_10252990 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 804 | Open in IMG/M |
3300006810|Ga0070754_10326808 | Not Available | 683 | Open in IMG/M |
3300006868|Ga0075481_10202435 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Tevenvirinae → Tequatrovirus | 709 | Open in IMG/M |
3300007216|Ga0103961_1281931 | All Organisms → Viruses → Predicted Viral | 1372 | Open in IMG/M |
3300007538|Ga0099851_1074060 | All Organisms → Viruses → Predicted Viral | 1316 | Open in IMG/M |
3300007538|Ga0099851_1121891 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 984 | Open in IMG/M |
3300007538|Ga0099851_1134976 | Not Available | 926 | Open in IMG/M |
3300007538|Ga0099851_1193566 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → Alisovirus → Alisovirus socal22 | 742 | Open in IMG/M |
3300007538|Ga0099851_1359013 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 507 | Open in IMG/M |
3300007539|Ga0099849_1000633 | Not Available | 16146 | Open in IMG/M |
3300007539|Ga0099849_1003158 | All Organisms → Viruses | 7605 | Open in IMG/M |
3300007539|Ga0099849_1003812 | Not Available | 6959 | Open in IMG/M |
3300007539|Ga0099849_1016764 | All Organisms → Viruses → Predicted Viral | 3210 | Open in IMG/M |
3300007539|Ga0099849_1028876 | All Organisms → Viruses → Predicted Viral | 2380 | Open in IMG/M |
3300007539|Ga0099849_1103321 | All Organisms → Viruses → Predicted Viral | 1134 | Open in IMG/M |
3300007539|Ga0099849_1110256 | All Organisms → Viruses → Predicted Viral | 1090 | Open in IMG/M |
3300007539|Ga0099849_1156054 | Not Available | 880 | Open in IMG/M |
3300007539|Ga0099849_1161345 | Not Available | 862 | Open in IMG/M |
3300007539|Ga0099849_1259021 | Not Available | 637 | Open in IMG/M |
3300007539|Ga0099849_1264474 | Not Available | 629 | Open in IMG/M |
3300007541|Ga0099848_1284550 | Not Available | 571 | Open in IMG/M |
3300007541|Ga0099848_1287229 | Not Available | 567 | Open in IMG/M |
3300007542|Ga0099846_1297986 | Not Available | 553 | Open in IMG/M |
3300007544|Ga0102861_1225357 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → Greenvirus | 518 | Open in IMG/M |
3300007630|Ga0102903_1229469 | Not Available | 502 | Open in IMG/M |
3300007640|Ga0070751_1160210 | Not Available | 895 | Open in IMG/M |
3300007670|Ga0102862_1021912 | All Organisms → Viruses → Predicted Viral | 1481 | Open in IMG/M |
3300007735|Ga0104988_11027 | All Organisms → Viruses | 213274 | Open in IMG/M |
3300007960|Ga0099850_1018258 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 3128 | Open in IMG/M |
3300007960|Ga0099850_1247423 | All Organisms → cellular organisms → Archaea → DPANN group → Candidatus Woesearchaeota → Candidatus Woesearchaeota archaeon | 688 | Open in IMG/M |
3300007960|Ga0099850_1317233 | Not Available | 589 | Open in IMG/M |
3300007960|Ga0099850_1390755 | Not Available | 516 | Open in IMG/M |
3300008055|Ga0108970_10557097 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 1305 | Open in IMG/M |
3300008105|Ga0114338_1080504 | All Organisms → Viruses → Predicted Viral | 1236 | Open in IMG/M |
3300008107|Ga0114340_1000423 | Not Available | 50509 | Open in IMG/M |
3300008107|Ga0114340_1052238 | All Organisms → Viruses → Predicted Viral | 2151 | Open in IMG/M |
3300008113|Ga0114346_1141578 | All Organisms → Viruses → Predicted Viral | 1040 | Open in IMG/M |
3300008120|Ga0114355_1029124 | All Organisms → Viruses → Predicted Viral | 2773 | Open in IMG/M |
3300008266|Ga0114363_1071355 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Llyrvirus → Synechococcus virus SSKS1 | 1319 | Open in IMG/M |
3300008448|Ga0114876_1000335 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 37045 | Open in IMG/M |
3300009000|Ga0102960_1224601 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 667 | Open in IMG/M |
3300009001|Ga0102963_1377025 | Not Available | 556 | Open in IMG/M |
3300009009|Ga0105105_10656836 | Not Available | 619 | Open in IMG/M |
3300009085|Ga0105103_10032031 | All Organisms → Viruses → Predicted Viral | 2617 | Open in IMG/M |
3300009124|Ga0118687_10308815 | Not Available | 597 | Open in IMG/M |
3300009146|Ga0105091_10022216 | All Organisms → Viruses → Predicted Viral | 2723 | Open in IMG/M |
3300009146|Ga0105091_10088396 | All Organisms → Viruses → Predicted Viral | 1409 | Open in IMG/M |
3300009165|Ga0105102_10442115 | Not Available | 697 | Open in IMG/M |
3300009169|Ga0105097_10430153 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Tevenvirinae → Tequatrovirus | 735 | Open in IMG/M |
3300009218|Ga0103848_1028636 | All Organisms → Viruses → Predicted Viral | 1057 | Open in IMG/M |
3300009331|Ga0103824_100985 | All Organisms → Viruses → Predicted Viral | 1604 | Open in IMG/M |
3300009338|Ga0103826_100884 | All Organisms → Viruses → Predicted Viral | 2199 | Open in IMG/M |
3300009338|Ga0103826_101013 | All Organisms → Viruses → Predicted Viral | 2066 | Open in IMG/M |
3300009338|Ga0103826_101665 | All Organisms → Viruses → Predicted Viral | 1649 | Open in IMG/M |
3300010296|Ga0129348_1060247 | All Organisms → Viruses → Predicted Viral | 1361 | Open in IMG/M |
3300010296|Ga0129348_1273347 | Not Available | 566 | Open in IMG/M |
3300010297|Ga0129345_1006924 | All Organisms → Viruses → Predicted Viral | 4405 | Open in IMG/M |
3300010297|Ga0129345_1048118 | All Organisms → Viruses → Predicted Viral | 1636 | Open in IMG/M |
3300010297|Ga0129345_1237161 | Not Available | 639 | Open in IMG/M |
3300010297|Ga0129345_1356164 | Not Available | 503 | Open in IMG/M |
3300010299|Ga0129342_1046555 | All Organisms → Viruses → Predicted Viral | 1711 | Open in IMG/M |
3300010299|Ga0129342_1187288 | Not Available | 740 | Open in IMG/M |
3300010299|Ga0129342_1208027 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 693 | Open in IMG/M |
3300010299|Ga0129342_1253405 | Not Available | 613 | Open in IMG/M |
3300010300|Ga0129351_1066762 | All Organisms → Viruses → Predicted Viral | 1463 | Open in IMG/M |
3300010300|Ga0129351_1280034 | Not Available | 634 | Open in IMG/M |
3300010318|Ga0136656_1036361 | All Organisms → Viruses → Predicted Viral | 1785 | Open in IMG/M |
3300010318|Ga0136656_1122795 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → Greenvirus | 900 | Open in IMG/M |
3300010318|Ga0136656_1264941 | Not Available | 564 | Open in IMG/M |
3300010354|Ga0129333_10000039 | All Organisms → Viruses | 69453 | Open in IMG/M |
3300010354|Ga0129333_10029305 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 5206 | Open in IMG/M |
3300010354|Ga0129333_10042897 | All Organisms → Viruses → Predicted Viral | 4252 | Open in IMG/M |
3300010354|Ga0129333_10089419 | All Organisms → Viruses → Predicted Viral | 2849 | Open in IMG/M |
3300010354|Ga0129333_10092023 | All Organisms → Viruses → Predicted Viral | 2804 | Open in IMG/M |
3300010354|Ga0129333_10108289 | All Organisms → Viruses → Predicted Viral | 2565 | Open in IMG/M |
3300010354|Ga0129333_10116713 | All Organisms → Viruses → Predicted Viral | 2460 | Open in IMG/M |
3300010354|Ga0129333_10167215 | All Organisms → Viruses → Predicted Viral | 2013 | Open in IMG/M |
3300010354|Ga0129333_10180537 | All Organisms → Viruses → Predicted Viral | 1926 | Open in IMG/M |
3300010354|Ga0129333_10181861 | All Organisms → Viruses → Predicted Viral | 1918 | Open in IMG/M |
3300010354|Ga0129333_10200076 | All Organisms → Viruses → Predicted Viral | 1817 | Open in IMG/M |
3300010354|Ga0129333_10251844 | All Organisms → Viruses → Predicted Viral | 1591 | Open in IMG/M |
3300010354|Ga0129333_10267277 | All Organisms → Viruses → Predicted Viral | 1538 | Open in IMG/M |
3300010354|Ga0129333_10276131 | All Organisms → Viruses → Predicted Viral | 1509 | Open in IMG/M |
3300010354|Ga0129333_10358272 | All Organisms → Viruses → Predicted Viral | 1296 | Open in IMG/M |
3300010354|Ga0129333_10433084 | All Organisms → Viruses → Predicted Viral | 1160 | Open in IMG/M |
3300010354|Ga0129333_10710006 | Not Available | 864 | Open in IMG/M |
3300010354|Ga0129333_10752610 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 834 | Open in IMG/M |
3300010354|Ga0129333_11058553 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 679 | Open in IMG/M |
3300010354|Ga0129333_11371131 | Not Available | 582 | Open in IMG/M |
3300010354|Ga0129333_11598403 | Not Available | 532 | Open in IMG/M |
3300010354|Ga0129333_11755030 | Not Available | 504 | Open in IMG/M |
3300010368|Ga0129324_10280197 | Not Available | 659 | Open in IMG/M |
3300010370|Ga0129336_10545450 | Not Available | 622 | Open in IMG/M |
3300010370|Ga0129336_10698630 | Not Available | 537 | Open in IMG/M |
3300010389|Ga0136549_10131974 | All Organisms → Viruses → Predicted Viral | 1140 | Open in IMG/M |
3300010389|Ga0136549_10314522 | Not Available | 648 | Open in IMG/M |
3300010412|Ga0136852_10275348 | All Organisms → Viruses → Predicted Viral | 1663 | Open in IMG/M |
3300010412|Ga0136852_11266817 | Not Available | 700 | Open in IMG/M |
3300010996|Ga0139308_126214 | Not Available | 867 | Open in IMG/M |
3300011113|Ga0151517_1463 | Not Available | 14900 | Open in IMG/M |
3300011268|Ga0151620_1001275 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae | 9715 | Open in IMG/M |
3300011268|Ga0151620_1029462 | All Organisms → Viruses → Predicted Viral | 1877 | Open in IMG/M |
3300011268|Ga0151620_1038398 | All Organisms → Viruses → Predicted Viral | 1609 | Open in IMG/M |
3300012000|Ga0119951_1005439 | Not Available | 6060 | Open in IMG/M |
3300012520|Ga0129344_1128008 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 769 | Open in IMG/M |
3300012520|Ga0129344_1326519 | All Organisms → Viruses → Predicted Viral | 1542 | Open in IMG/M |
3300012520|Ga0129344_1434858 | Not Available | 511 | Open in IMG/M |
3300012520|Ga0129344_1437459 | Not Available | 659 | Open in IMG/M |
3300012963|Ga0129340_1322477 | Not Available | 619 | Open in IMG/M |
3300012968|Ga0129337_1175925 | All Organisms → Viruses → Predicted Viral | 1101 | Open in IMG/M |
3300013005|Ga0164292_10350130 | Not Available | 998 | Open in IMG/M |
3300013087|Ga0163212_1120726 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → Charybdisvirus → Charybdisvirus scam3 | 836 | Open in IMG/M |
3300013087|Ga0163212_1184606 | Not Available | 654 | Open in IMG/M |
3300013087|Ga0163212_1285275 | Not Available | 511 | Open in IMG/M |
(restricted) 3300013123|Ga0172368_10283896 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 793 | Open in IMG/M |
(restricted) 3300013126|Ga0172367_10158883 | All Organisms → Viruses → Predicted Viral | 1480 | Open in IMG/M |
(restricted) 3300013126|Ga0172367_10282582 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 989 | Open in IMG/M |
(restricted) 3300013126|Ga0172367_10485354 | Not Available | 681 | Open in IMG/M |
(restricted) 3300013127|Ga0172365_10134913 | All Organisms → Viruses → Predicted Viral | 1550 | Open in IMG/M |
(restricted) 3300013129|Ga0172364_10046114 | All Organisms → Viruses → Predicted Viral | 3174 | Open in IMG/M |
(restricted) 3300013131|Ga0172373_10146773 | All Organisms → Viruses → Predicted Viral | 1683 | Open in IMG/M |
(restricted) 3300013132|Ga0172372_10042251 | All Organisms → Viruses → Predicted Viral | 4578 | Open in IMG/M |
(restricted) 3300013137|Ga0172375_10856379 | Not Available | 554 | Open in IMG/M |
3300014819|Ga0119954_1001109 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01 | 9100 | Open in IMG/M |
3300016743|Ga0182083_1044182 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 782 | Open in IMG/M |
3300016771|Ga0182082_1020808 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Tamkungvirus → Tamkungvirus ST4 | 551 | Open in IMG/M |
3300017818|Ga0181565_10000612 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 26921 | Open in IMG/M |
3300017818|Ga0181565_10015773 | Not Available | 5645 | Open in IMG/M |
3300017818|Ga0181565_10270164 | All Organisms → Viruses → Predicted Viral | 1149 | Open in IMG/M |
3300017818|Ga0181565_10475366 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 815 | Open in IMG/M |
3300017818|Ga0181565_10750080 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae | 616 | Open in IMG/M |
3300017949|Ga0181584_10068406 | All Organisms → Viruses → Predicted Viral | 2472 | Open in IMG/M |
3300017949|Ga0181584_10090538 | All Organisms → Viruses → Predicted Viral | 2102 | Open in IMG/M |
3300017949|Ga0181584_10107692 | All Organisms → Viruses → Predicted Viral | 1901 | Open in IMG/M |
3300017949|Ga0181584_10116500 | All Organisms → Viruses → Predicted Viral | 1815 | Open in IMG/M |
3300017949|Ga0181584_10140478 | All Organisms → Viruses → Predicted Viral | 1625 | Open in IMG/M |
3300017949|Ga0181584_10242849 | All Organisms → Viruses → Predicted Viral | 1170 | Open in IMG/M |
3300017949|Ga0181584_10677449 | Not Available | 618 | Open in IMG/M |
3300017949|Ga0181584_10855746 | Not Available | 535 | Open in IMG/M |
3300017951|Ga0181577_10086070 | All Organisms → Viruses → Predicted Viral | 2189 | Open in IMG/M |
3300017952|Ga0181583_10374886 | Not Available | 890 | Open in IMG/M |
3300017952|Ga0181583_10462467 | Not Available | 781 | Open in IMG/M |
3300017956|Ga0181580_10238177 | All Organisms → Viruses → Predicted Viral | 1261 | Open in IMG/M |
3300017956|Ga0181580_10270701 | All Organisms → Viruses → Predicted Viral | 1166 | Open in IMG/M |
3300017956|Ga0181580_10471131 | All Organisms → Viruses | 825 | Open in IMG/M |
3300017956|Ga0181580_10476688 | Not Available | 819 | Open in IMG/M |
3300017956|Ga0181580_10499097 | Not Available | 796 | Open in IMG/M |
3300017956|Ga0181580_10618434 | Not Available | 696 | Open in IMG/M |
3300017956|Ga0181580_10742678 | Not Available | 621 | Open in IMG/M |
3300017956|Ga0181580_10793465 | Not Available | 597 | Open in IMG/M |
3300017958|Ga0181582_10849098 | Not Available | 540 | Open in IMG/M |
3300017958|Ga0181582_10851582 | Not Available | 539 | Open in IMG/M |
3300017958|Ga0181582_10905904 | Not Available | 518 | Open in IMG/M |
3300017962|Ga0181581_10619520 | Not Available | 657 | Open in IMG/M |
3300017962|Ga0181581_10793049 | Not Available | 564 | Open in IMG/M |
3300017967|Ga0181590_10044815 | All Organisms → Viruses → Predicted Viral | 3543 | Open in IMG/M |
3300017967|Ga0181590_10489060 | Not Available | 859 | Open in IMG/M |
3300017967|Ga0181590_10964149 | Not Available | 558 | Open in IMG/M |
3300017968|Ga0181587_10831163 | Not Available | 575 | Open in IMG/M |
3300017969|Ga0181585_10691314 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 668 | Open in IMG/M |
3300017985|Ga0181576_10460703 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Tamkungvirus → Tamkungvirus ST4 | 786 | Open in IMG/M |
3300017985|Ga0181576_10562432 | Not Available | 694 | Open in IMG/M |
3300018039|Ga0181579_10568385 | Not Available | 589 | Open in IMG/M |
3300018421|Ga0181592_10107600 | All Organisms → Viruses → Predicted Viral | 2162 | Open in IMG/M |
3300018421|Ga0181592_10233288 | All Organisms → Viruses → Predicted Viral | 1359 | Open in IMG/M |
3300018421|Ga0181592_10513484 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Tamkungvirus → Tamkungvirus ST4 | 826 | Open in IMG/M |
3300018421|Ga0181592_10747546 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Tevenvirinae → Tequatrovirus | 649 | Open in IMG/M |
3300018424|Ga0181591_10216626 | All Organisms → Viruses → Predicted Viral | 1498 | Open in IMG/M |
3300018424|Ga0181591_10571646 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae | 813 | Open in IMG/M |
3300018424|Ga0181591_10898772 | Not Available | 608 | Open in IMG/M |
3300019708|Ga0194016_1025489 | Not Available | 674 | Open in IMG/M |
3300019756|Ga0194023_1047979 | Not Available | 859 | Open in IMG/M |
3300019765|Ga0194024_1054955 | Not Available | 885 | Open in IMG/M |
3300020074|Ga0194113_10126149 | All Organisms → Viruses → Predicted Viral | 2175 | Open in IMG/M |
3300020074|Ga0194113_10153844 | All Organisms → Viruses → Predicted Viral | 1906 | Open in IMG/M |
3300020074|Ga0194113_10287270 | All Organisms → Viruses → Predicted Viral | 1255 | Open in IMG/M |
3300020074|Ga0194113_10343193 | All Organisms → Viruses → Predicted Viral | 1116 | Open in IMG/M |
3300020074|Ga0194113_10520106 | Not Available | 851 | Open in IMG/M |
3300020074|Ga0194113_10778960 | Not Available | 656 | Open in IMG/M |
3300020074|Ga0194113_10889659 | Not Available | 602 | Open in IMG/M |
3300020074|Ga0194113_11104009 | Not Available | 523 | Open in IMG/M |
3300020074|Ga0194113_11120252 | Not Available | 518 | Open in IMG/M |
3300020074|Ga0194113_11120254 | Not Available | 518 | Open in IMG/M |
3300020083|Ga0194111_10381719 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 939 | Open in IMG/M |
3300020083|Ga0194111_10387120 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 930 | Open in IMG/M |
3300020084|Ga0194110_10534537 | Not Available | 757 | Open in IMG/M |
3300020109|Ga0194112_10614073 | Not Available | 739 | Open in IMG/M |
3300020141|Ga0211732_1234470 | All Organisms → Viruses → Predicted Viral | 1033 | Open in IMG/M |
3300020151|Ga0211736_10249791 | All Organisms → Viruses → Predicted Viral | 1285 | Open in IMG/M |
3300020151|Ga0211736_10512693 | All Organisms → Viruses → Predicted Viral | 4275 | Open in IMG/M |
3300020151|Ga0211736_10572956 | All Organisms → Viruses | 6188 | Open in IMG/M |
3300020151|Ga0211736_10820714 | All Organisms → Viruses → Predicted Viral | 1358 | Open in IMG/M |
3300020159|Ga0211734_11255440 | All Organisms → Viruses → Predicted Viral | 2920 | Open in IMG/M |
3300020172|Ga0211729_10157470 | All Organisms → Viruses → Predicted Viral | 2470 | Open in IMG/M |
3300020179|Ga0194134_10051605 | All Organisms → Viruses → Predicted Viral | 2264 | Open in IMG/M |
3300020183|Ga0194115_10011731 | Not Available | 7899 | Open in IMG/M |
3300020183|Ga0194115_10014490 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Llyrvirus → Synechococcus virus SSKS1 | 6744 | Open in IMG/M |
3300020183|Ga0194115_10017063 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 5956 | Open in IMG/M |
3300020183|Ga0194115_10187329 | All Organisms → Viruses → Predicted Viral | 1035 | Open in IMG/M |
3300020183|Ga0194115_10362051 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae | 637 | Open in IMG/M |
3300020183|Ga0194115_10425416 | Not Available | 563 | Open in IMG/M |
3300020183|Ga0194115_10463049 | Not Available | 527 | Open in IMG/M |
3300020189|Ga0181578_10111361 | All Organisms → Viruses → Predicted Viral | 1516 | Open in IMG/M |
3300020189|Ga0181578_10442432 | Not Available | 554 | Open in IMG/M |
3300020190|Ga0194118_10124929 | All Organisms → Viruses → Predicted Viral | 1544 | Open in IMG/M |
3300020190|Ga0194118_10395629 | Not Available | 700 | Open in IMG/M |
3300020196|Ga0194124_10065735 | All Organisms → Viruses → Predicted Viral | 2190 | Open in IMG/M |
3300020196|Ga0194124_10501813 | Not Available | 529 | Open in IMG/M |
3300020222|Ga0194125_10255008 | All Organisms → Viruses → Predicted Viral | 1198 | Open in IMG/M |
3300020488|Ga0208051_100873 | All Organisms → Viruses → Predicted Viral | 3884 | Open in IMG/M |
3300020498|Ga0208050_1019438 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → Greenvirus | 710 | Open in IMG/M |
3300020547|Ga0208361_1032223 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Tevenvirinae → Tequatrovirus | 704 | Open in IMG/M |
3300020570|Ga0208465_1000023 | Not Available | 61094 | Open in IMG/M |
3300020578|Ga0194129_10559300 | Not Available | 547 | Open in IMG/M |
3300020603|Ga0194126_10152185 | All Organisms → Viruses → Predicted Viral | 1744 | Open in IMG/M |
3300020603|Ga0194126_10854783 | Not Available | 513 | Open in IMG/M |
3300021091|Ga0194133_10110649 | All Organisms → Viruses → Predicted Viral | 2073 | Open in IMG/M |
3300021335|Ga0213867_1001374 | All Organisms → Viruses | 10844 | Open in IMG/M |
3300021335|Ga0213867_1056690 | All Organisms → Viruses → Predicted Viral | 1482 | Open in IMG/M |
3300021356|Ga0213858_10059615 | All Organisms → Viruses → Predicted Viral | 1853 | Open in IMG/M |
3300021356|Ga0213858_10089877 | All Organisms → Viruses → Predicted Viral | 1499 | Open in IMG/M |
3300021368|Ga0213860_10087137 | All Organisms → Viruses → Predicted Viral | 1358 | Open in IMG/M |
3300021373|Ga0213865_10026998 | All Organisms → Viruses → Predicted Viral | 3233 | Open in IMG/M |
3300021373|Ga0213865_10206437 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Atlauavirus | 968 | Open in IMG/M |
3300021376|Ga0194130_10007631 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 11827 | Open in IMG/M |
3300021376|Ga0194130_10472298 | Not Available | 648 | Open in IMG/M |
3300021376|Ga0194130_10626447 | Not Available | 530 | Open in IMG/M |
3300021424|Ga0194117_10251819 | Not Available | 850 | Open in IMG/M |
3300021425|Ga0213866_10034379 | All Organisms → Viruses → Predicted Viral | 2938 | Open in IMG/M |
3300021425|Ga0213866_10050919 | All Organisms → Viruses → Predicted Viral | 2348 | Open in IMG/M |
3300021425|Ga0213866_10078939 | All Organisms → Viruses → Predicted Viral | 1819 | Open in IMG/M |
3300021425|Ga0213866_10332087 | Not Available | 755 | Open in IMG/M |
3300021959|Ga0222716_10073664 | All Organisms → Viruses → Predicted Viral | 2363 | Open in IMG/M |
3300021959|Ga0222716_10594814 | Not Available | 605 | Open in IMG/M |
3300021960|Ga0222715_10023244 | All Organisms → Viruses → Predicted Viral | 4592 | Open in IMG/M |
3300021960|Ga0222715_10024156 | All Organisms → Viruses → Predicted Viral | 4483 | Open in IMG/M |
3300021960|Ga0222715_10042561 | All Organisms → Viruses → Predicted Viral | 3186 | Open in IMG/M |
3300021960|Ga0222715_10191352 | All Organisms → Viruses → Predicted Viral | 1231 | Open in IMG/M |
3300021960|Ga0222715_10206560 | All Organisms → Viruses → Predicted Viral | 1171 | Open in IMG/M |
3300021960|Ga0222715_10235383 | All Organisms → Viruses → Predicted Viral | 1074 | Open in IMG/M |
3300021960|Ga0222715_10466512 | Not Available | 676 | Open in IMG/M |
3300021960|Ga0222715_10613547 | Not Available | 560 | Open in IMG/M |
3300021961|Ga0222714_10000258 | All Organisms → Viruses | 63185 | Open in IMG/M |
3300021961|Ga0222714_10005359 | All Organisms → Viruses | 12247 | Open in IMG/M |
3300021961|Ga0222714_10010974 | Not Available | 7782 | Open in IMG/M |
3300021961|Ga0222714_10011712 | Not Available | 7422 | Open in IMG/M |
3300021961|Ga0222714_10021162 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 5073 | Open in IMG/M |
3300021961|Ga0222714_10066133 | All Organisms → Viruses → Predicted Viral | 2417 | Open in IMG/M |
3300021961|Ga0222714_10113243 | All Organisms → Viruses → Predicted Viral | 1690 | Open in IMG/M |
3300021961|Ga0222714_10173671 | All Organisms → Viruses → Predicted Viral | 1268 | Open in IMG/M |
3300021961|Ga0222714_10187226 | All Organisms → Viruses → Predicted Viral | 1206 | Open in IMG/M |
3300021961|Ga0222714_10470295 | Not Available | 651 | Open in IMG/M |
3300021961|Ga0222714_10507854 | Not Available | 617 | Open in IMG/M |
3300021962|Ga0222713_10001202 | Not Available | 29490 | Open in IMG/M |
3300021962|Ga0222713_10664062 | Not Available | 599 | Open in IMG/M |
3300021963|Ga0222712_10194964 | All Organisms → Viruses → Predicted Viral | 1331 | Open in IMG/M |
3300021963|Ga0222712_10329786 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Tevenvirinae → Tequatrovirus | 947 | Open in IMG/M |
3300021963|Ga0222712_10598342 | Not Available | 637 | Open in IMG/M |
3300022050|Ga0196883_1016032 | Not Available | 896 | Open in IMG/M |
3300022176|Ga0212031_1030987 | Not Available | 867 | Open in IMG/M |
3300022179|Ga0181353_1079889 | Not Available | 827 | Open in IMG/M |
3300022187|Ga0196899_1032885 | All Organisms → Viruses → Predicted Viral | 1806 | Open in IMG/M |
3300022198|Ga0196905_1012770 | All Organisms → Viruses → Predicted Viral | 2739 | Open in IMG/M |
3300022198|Ga0196905_1018489 | All Organisms → Viruses → Predicted Viral | 2200 | Open in IMG/M |
3300022198|Ga0196905_1036391 | All Organisms → Viruses → Predicted Viral | 1454 | Open in IMG/M |
3300022198|Ga0196905_1171235 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Nodensvirus → Synechococcus virus SPM2 → Synechococcus phage S-PM2 | 552 | Open in IMG/M |
3300022198|Ga0196905_1181515 | Not Available | 532 | Open in IMG/M |
3300022200|Ga0196901_1029985 | All Organisms → Viruses → Predicted Viral | 2127 | Open in IMG/M |
3300022200|Ga0196901_1043803 | All Organisms → Viruses → Predicted Viral | 1696 | Open in IMG/M |
3300022200|Ga0196901_1086659 | All Organisms → Viruses → Predicted Viral | 1109 | Open in IMG/M |
3300022752|Ga0214917_10006104 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01 | 12646 | Open in IMG/M |
3300022752|Ga0214917_10461976 | All Organisms → cellular organisms → Bacteria | 503 | Open in IMG/M |
3300022934|Ga0255781_10397856 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Tamkungvirus → Tamkungvirus ST4 | 586 | Open in IMG/M |
3300022935|Ga0255780_10066818 | All Organisms → Viruses → Predicted Viral | 2248 | Open in IMG/M |
3300022935|Ga0255780_10340801 | Not Available | 691 | Open in IMG/M |
3300022935|Ga0255780_10347159 | Not Available | 681 | Open in IMG/M |
3300023081|Ga0255764_10446639 | Not Available | 547 | Open in IMG/M |
3300023084|Ga0255778_10194430 | All Organisms → Viruses → Predicted Viral | 1017 | Open in IMG/M |
3300023116|Ga0255751_10156972 | All Organisms → Viruses → Predicted Viral | 1326 | Open in IMG/M |
3300023176|Ga0255772_10238284 | All Organisms → Viruses → Predicted Viral | 1003 | Open in IMG/M |
3300023180|Ga0255768_10086776 | All Organisms → Viruses → Predicted Viral | 2144 | Open in IMG/M |
3300024348|Ga0244776_10337583 | All Organisms → Viruses → Predicted Viral | 1018 | Open in IMG/M |
3300024480|Ga0255223_1012565 | All Organisms → Viruses → Predicted Viral | 1328 | Open in IMG/M |
3300025585|Ga0208546_1002939 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 5005 | Open in IMG/M |
3300025610|Ga0208149_1054926 | All Organisms → Viruses → Predicted Viral | 1022 | Open in IMG/M |
3300025646|Ga0208161_1051198 | All Organisms → Viruses → Predicted Viral | 1320 | Open in IMG/M |
3300025653|Ga0208428_1037529 | All Organisms → Viruses → Predicted Viral | 1518 | Open in IMG/M |
3300025655|Ga0208795_1086475 | Not Available | 860 | Open in IMG/M |
3300025655|Ga0208795_1154536 | Not Available | 570 | Open in IMG/M |
3300025671|Ga0208898_1152252 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 623 | Open in IMG/M |
3300025674|Ga0208162_1000471 | All Organisms → Viruses | 23501 | Open in IMG/M |
3300025674|Ga0208162_1001062 | All Organisms → Viruses | 14803 | Open in IMG/M |
3300025674|Ga0208162_1007796 | All Organisms → Viruses → Predicted Viral | 4712 | Open in IMG/M |
3300025674|Ga0208162_1078942 | All Organisms → Viruses → Predicted Viral | 1023 | Open in IMG/M |
3300025674|Ga0208162_1083484 | Not Available | 983 | Open in IMG/M |
3300025687|Ga0208019_1059689 | All Organisms → Viruses → Predicted Viral | 1285 | Open in IMG/M |
3300025771|Ga0208427_1086924 | All Organisms → Viruses → Predicted Viral | 1097 | Open in IMG/M |
3300026085|Ga0208880_1014077 | All Organisms → Viruses → Predicted Viral | 1672 | Open in IMG/M |
3300026837|Ga0209856_1002796 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Tevenvirinae → Tequatrovirus | 839 | Open in IMG/M |
3300027152|Ga0255100_1093478 | Not Available | 519 | Open in IMG/M |
3300027393|Ga0209867_1022758 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales → Myoviridae → Tevenvirinae → Tequatrovirus | 903 | Open in IMG/M |
3300027597|Ga0255088_1089781 | Not Available | 572 | Open in IMG/M |
3300027721|Ga0209492_1006833 | All Organisms → Viruses → Predicted Viral | 3757 | Open in IMG/M |
3300027792|Ga0209287_10341695 | Not Available | 575 | Open in IMG/M |
3300027816|Ga0209990_10054134 | All Organisms → Viruses → Predicted Viral | 2036 | Open in IMG/M |
3300027917|Ga0209536_100572766 | All Organisms → Viruses → Predicted Viral | 1407 | Open in IMG/M |
3300027917|Ga0209536_100830238 | All Organisms → Viruses → Predicted Viral | 1144 | Open in IMG/M |
3300027917|Ga0209536_100988687 | All Organisms → Viruses → Predicted Viral | 1037 | Open in IMG/M |
3300027940|Ga0209893_1004873 | Not Available | 963 | Open in IMG/M |
3300029699|Ga0255233_1103692 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 565 | Open in IMG/M |
3300029930|Ga0119944_1000943 | Not Available | 5233 | Open in IMG/M |
3300029930|Ga0119944_1003248 | All Organisms → Viruses → Predicted Viral | 2737 | Open in IMG/M |
3300029930|Ga0119944_1004769 | All Organisms → Viruses → Predicted Viral | 2201 | Open in IMG/M |
3300029930|Ga0119944_1005699 | All Organisms → Viruses → Predicted Viral | 1997 | Open in IMG/M |
3300029930|Ga0119944_1007400 | All Organisms → Viruses → Predicted Viral | 1718 | Open in IMG/M |
3300029930|Ga0119944_1009139 | All Organisms → Viruses → Predicted Viral | 1513 | Open in IMG/M |
3300029930|Ga0119944_1013496 | All Organisms → Viruses → Predicted Viral | 1185 | Open in IMG/M |
3300029930|Ga0119944_1042178 | Not Available | 562 | Open in IMG/M |
3300029932|Ga0119933_1000486 | All Organisms → Viruses | 7002 | Open in IMG/M |
3300031578|Ga0307376_10760847 | Not Available | 602 | Open in IMG/M |
3300031578|Ga0307376_10787869 | All Organisms → Viruses | 589 | Open in IMG/M |
3300031758|Ga0315907_10131496 | All Organisms → Viruses → Predicted Viral | 2130 | Open in IMG/M |
3300031758|Ga0315907_10777163 | Not Available | 718 | Open in IMG/M |
3300031784|Ga0315899_10029234 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 5817 | Open in IMG/M |
3300031857|Ga0315909_10230799 | All Organisms → Viruses → Predicted Viral | 1438 | Open in IMG/M |
3300031857|Ga0315909_10808985 | Not Available | 591 | Open in IMG/M |
3300031857|Ga0315909_10824370 | Not Available | 583 | Open in IMG/M |
3300031951|Ga0315904_10099099 | All Organisms → Viruses → Predicted Viral | 3069 | Open in IMG/M |
3300031951|Ga0315904_10423349 | All Organisms → Viruses → Predicted Viral | 1199 | Open in IMG/M |
3300031951|Ga0315904_10729087 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Caudovirales | 828 | Open in IMG/M |
3300032050|Ga0315906_10064368 | All Organisms → Viruses → Predicted Viral | 3759 | Open in IMG/M |
3300032050|Ga0315906_10798889 | Not Available | 740 | Open in IMG/M |
3300033521|Ga0316616_100000009 | All Organisms → Viruses | 59370 | Open in IMG/M |
3300033978|Ga0334977_0000608 | Not Available | 21474 | Open in IMG/M |
3300033979|Ga0334978_0167150 | All Organisms → Viruses → Predicted Viral | 1090 | Open in IMG/M |
3300033994|Ga0334996_0009290 | Not Available | 6563 | Open in IMG/M |
3300034012|Ga0334986_0005204 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 9945 | Open in IMG/M |
3300034012|Ga0334986_0195068 | All Organisms → Viruses → Predicted Viral | 1136 | Open in IMG/M |
3300034072|Ga0310127_265603 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → Kyanoviridae → unclassified Kyanoviridae → Synechococcus phage S-SRM01 | 602 | Open in IMG/M |
3300034073|Ga0310130_0003820 | Not Available | 6326 | Open in IMG/M |
3300034073|Ga0310130_0009465 | All Organisms → Viruses → Predicted Viral | 3479 | Open in IMG/M |
3300034073|Ga0310130_0013035 | All Organisms → Viruses → Predicted Viral | 2820 | Open in IMG/M |
3300034073|Ga0310130_0054455 | All Organisms → Viruses → Predicted Viral | 1193 | Open in IMG/M |
3300034073|Ga0310130_0229915 | Not Available | 581 | Open in IMG/M |
3300034073|Ga0310130_0277084 | Not Available | 531 | Open in IMG/M |
3300034102|Ga0335029_0000154 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes | 58367 | Open in IMG/M |
3300034102|Ga0335029_0107150 | All Organisms → Viruses → Predicted Viral | 1965 | Open in IMG/M |
3300034102|Ga0335029_0181193 | All Organisms → Viruses → Predicted Viral | 1415 | Open in IMG/M |
3300034418|Ga0348337_135217 | All Organisms → Viruses → Duplodnaviria → Heunggongvirae → Uroviricota → Caudoviricetes → unclassified Caudoviricetes → Caudoviricetes sp. | 727 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Aqueous | Environmental → Aquatic → Marine → Coastal → Unclassified → Aqueous | 18.38% |
Salt Marsh | Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh | 14.32% |
Freshwater To Marine Saline Gradient | Environmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient | 10.02% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake | 8.83% |
Estuarine Water | Environmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water | 6.44% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 5.01% |
Freshwater Lake | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake | 2.63% |
Freshwater | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater | 2.63% |
Freshwater | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → Freshwater | 2.63% |
Seawater | Environmental → Aquatic → Marine → Coastal → Unclassified → Seawater | 2.63% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment | 2.15% |
Aquatic | Environmental → Aquatic → Freshwater → Drinking Water → Unclassified → Aquatic | 1.91% |
Marine | Environmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine | 1.67% |
Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Sand | 1.67% |
Fracking Water | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Fracking Water | 1.67% |
Lake | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake | 1.19% |
River Water | Environmental → Aquatic → Freshwater → Unclassified → Unclassified → River Water | 1.19% |
Freshwater | Environmental → Aquatic → Freshwater → Lentic → Epilimnion → Freshwater | 1.43% |
Freshwater, Plankton | Environmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater, Plankton | 1.43% |
Marine Plankton | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine Plankton | 1.43% |
Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.95% |
Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 0.95% |
Estuarine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine | 0.95% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.48% |
Freshwater | Environmental → Aquatic → Freshwater → River → Unclassified → Freshwater | 0.48% |
Pond Water | Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Pond Water | 0.48% |
Marine Methane Seep Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Marine Methane Seep Sediment | 0.48% |
Mangrove Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Mangrove Sediment | 0.48% |
Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.48% |
Freshwater Lentic | Environmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic | 0.24% |
Lake Water | Environmental → Aquatic → Freshwater → Lake → Unclassified → Lake Water | 0.24% |
Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Sediment | 0.24% |
Drinking Water Treatment Plant | Environmental → Aquatic → Freshwater → Drinking Water → Unclassified → Drinking Water Treatment Plant | 0.24% |
Wetland | Environmental → Aquatic → Marine → Wetlands → Sediment → Wetland | 0.24% |
Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment | 0.24% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.24% |
Deep Subsurface | Environmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface | 0.24% |
Estuary | Host-Associated → Plants → Leaf → Unclassified → Unclassified → Estuary | 0.24% |
Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment | 0.72% |
Freshwater | Environmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater | 0.72% |
Marine Sediment | Environmental → Aquatic → Marine → Oceanic → Sediment → Marine Sediment | 0.72% |
Marine | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine | 0.72% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
3300000116 | Marine microbial communities from Delaware Coast, sample from Delaware MO Spring March 2010 | Environmental | Open in IMG/M |
3300001213 | Combined assembly of wetland microbial communities from Twitchell Island in the Sacramento Delta (Jan 2013 JGI Velvet Assembly) | Environmental | Open in IMG/M |
3300001255 | Freshwater microbial communities from Lake Mendota, WI - 13JUN2010 deep hole epilimnion | Environmental | Open in IMG/M |
3300001818 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - ACM19, ROCA_DNA029_2.0um_3a | Environmental | Open in IMG/M |
3300001824 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - ACM36, ROCA_DNA073_0.2um_10g | Environmental | Open in IMG/M |
3300001826 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - ACM20, ROCA_DNA104_0.2um_23b | Environmental | Open in IMG/M |
3300001827 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - ACM21, ROCA_DNA110_2.0um_23k | Environmental | Open in IMG/M |
3300001828 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - ACM3, ROCA_DNA076_2.0um_10f | Environmental | Open in IMG/M |
3300001830 | Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - ACM40, ROCA_DNA028_0.2um_3l | Environmental | Open in IMG/M |
3300001955 | Marine microbial communities from Gulf of Panama, Panama - GS021 | Environmental | Open in IMG/M |
3300001968 | Marine microbial communities from Lake Gatun, Panama - GS020 | Environmental | Open in IMG/M |
3300002835 | Freshwater microbial communities from Lake Mendota, WI - (Lake Mendota Combined Ray assembly, ASSEMBLY_DATE=20140605) | Environmental | Open in IMG/M |
3300004240 | Freshwater lake microbial communities from Lake Michigan, USA - Fa13.BD.MLB.SN | Environmental | Open in IMG/M |
3300004481 | Combined Assembly of Gp0112041, Gp0112042, Gp0112043 | Environmental | Open in IMG/M |
3300005527 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG | Environmental | Open in IMG/M |
3300005581 | Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG ER78MSRF | Environmental | Open in IMG/M |
3300005662 | Freshwater lake microbial communities from Lake Michigan, USA - Su13.BD.MLB.SD (version 4) | Environmental | Open in IMG/M |
3300005739 | Cyanobacteria communities in tropical freswater systems - freshwater lake in Singapore | Environmental | Open in IMG/M |
3300005805 | Microbial and algae communities from Cheney Reservoir in Wichita, Kansas, USA | Environmental | Open in IMG/M |
3300005934 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S23_td_SurfaceB_ad_5m_LV_B | Environmental | Open in IMG/M |
3300005940 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_25-Nov-14 | Environmental | Open in IMG/M |
3300005943 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_4-Nov-14 | Environmental | Open in IMG/M |
3300006025 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_<0.8_DNA | Environmental | Open in IMG/M |
3300006026 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA | Environmental | Open in IMG/M |
3300006030 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA | Environmental | Open in IMG/M |
3300006637 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNA | Environmental | Open in IMG/M |
3300006639 | Deep subsurface shale carbon reservoir microbial communities from Ohio, USA - Utica-2 Time Series FC 2014_7_11 | Environmental | Open in IMG/M |
3300006802 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 | Environmental | Open in IMG/M |
3300006810 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 | Environmental | Open in IMG/M |
3300006868 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNA | Environmental | Open in IMG/M |
3300006870 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_>0.8_DNA | Environmental | Open in IMG/M |
3300007216 | Combined Assembly of cyanobacterial bloom in Punggol water reservoir, Singapore (Diel cycle-Surface and Bottom layer) 16 sequencing projects | Environmental | Open in IMG/M |
3300007234 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNA | Environmental | Open in IMG/M |
3300007538 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG | Environmental | Open in IMG/M |
3300007539 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG | Environmental | Open in IMG/M |
3300007541 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG | Environmental | Open in IMG/M |
3300007542 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG | Environmental | Open in IMG/M |
3300007544 | Estuarine microbial communities from the Columbia River estuary - metaG 1449B-3 | Environmental | Open in IMG/M |
3300007630 | Estuarine microbial communities from the Columbia River estuary - metaG 1555C-02 | Environmental | Open in IMG/M |
3300007640 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 | Environmental | Open in IMG/M |
3300007670 | Estuarine microbial communities from the Columbia River estuary - metaG 1449C-3 | Environmental | Open in IMG/M |
3300007735 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea ? 2014Oct | Environmental | Open in IMG/M |
3300007960 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG | Environmental | Open in IMG/M |
3300008055 | Metatranscriptomes of the Eelgrass leaves and roots. Combined Assembly of Gp0128390, Gp0128391, Gp0128392, and Gp0128393 | Host-Associated | Open in IMG/M |
3300008105 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, sample E2014-0046-100-LTR | Environmental | Open in IMG/M |
3300008107 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE2, Sample E2014-0046-3-NA | Environmental | Open in IMG/M |
3300008113 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE4, Sample E2014-0050-3-NA | Environmental | Open in IMG/M |
3300008120 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample E2014-0108-3-NA | Environmental | Open in IMG/M |
3300008266 | Freshwater microbial communities from Harmful Algal Blooms in Lake Erie, Western Basin, USA - Station WLE12, Sample HABS-E2014-0108-C-NA | Environmental | Open in IMG/M |
3300008448 | Freshwater viral communities during cyanobacterial harmful algal blooms (CHABs) in Western Lake Erie, USA - August 4, 2014 all contigs | Environmental | Open in IMG/M |
3300009000 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_B_H2O_MG | Environmental | Open in IMG/M |
3300009001 | Salt pond water microbial communities from South San Francisco under conditions of wetland restoration - Salt Pond MetaG SF2_C_H2O_MG | Environmental | Open in IMG/M |
3300009009 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
3300009085 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 10-12cm September2015 | Environmental | Open in IMG/M |
3300009124 | Marine sediment microbial communities from methane seeps within Hudson Canyon, US Atlantic Margin - Hudson Canyon PC-16 72 cmbsf | Environmental | Open in IMG/M |
3300009146 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm March2015 | Environmental | Open in IMG/M |
3300009165 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 | Environmental | Open in IMG/M |
3300009169 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 | Environmental | Open in IMG/M |
3300009218 | Microbial communities of water from Amazon river, Brazil - RCM1 | Environmental | Open in IMG/M |
3300009331 | Microbial communities of water from the North Atlantic ocean - ACM11 | Environmental | Open in IMG/M |
3300009338 | Microbial communities of water from the North Atlantic ocean - ACM29 | Environmental | Open in IMG/M |
3300010296 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_DNA | Environmental | Open in IMG/M |
3300010297 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_20_0.8_DNA | Environmental | Open in IMG/M |
3300010299 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_DNA | Environmental | Open in IMG/M |
3300010300 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.2_DNA | Environmental | Open in IMG/M |
3300010318 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.8_DNA | Environmental | Open in IMG/M |
3300010354 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.8_DNA | Environmental | Open in IMG/M |
3300010368 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_15_0.2_DNA | Environmental | Open in IMG/M |
3300010370 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_DNA | Environmental | Open in IMG/M |
3300010389 | Marine sediment microbial communities from methane seeps within Baltimore Canyon, US Atlantic Margin - Baltimore Canyon MUC-11 12-14 cmbsf | Environmental | Open in IMG/M |
3300010412 | Mangrove sediment microbial communities from Mai Po Nature Reserve Marshes in Hong Kong, China - Maipo_10 | Environmental | Open in IMG/M |
3300010996 | ELM11109_Aassembled -- Sediment microbial communities from coastal marsh in Port Sulphur, LA sequencing method A (2X250bp) | Environmental | Open in IMG/M |
3300011113 | Freshwater viral communities from Lake Soyang, Gangwon-do, South Korea - SYL_2015Sep | Environmental | Open in IMG/M |
3300011268 | Sub-surface freshwater microbial communities from San Francisco Estuary Delta, California, USA . Combined Assembly of Gp0173482, Gp0175554, Gp0175555 | Environmental | Open in IMG/M |
3300012000 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1007A | Environmental | Open in IMG/M |
3300012518 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_27_0.8_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012520 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_RNA2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012963 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.8_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012968 | Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_0.6_0.2_RNA1 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300013005 | Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES117 metaG | Environmental | Open in IMG/M |
3300013087 | Freshwater microbial communities from Lake Malawi, Central Region, Malawi to study Microbial Dark Matter (Phase II) - Malawi_45m_30L | Environmental | Open in IMG/M |
3300013123 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_11m | Environmental | Open in IMG/M |
3300013126 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_022012_10m | Environmental | Open in IMG/M |
3300013127 (restricted) | Sediment microbial communities from Lake Kivu, Rwanda - Sediment site 48cm | Environmental | Open in IMG/M |
3300013129 (restricted) | Sediment microbial communities from Lake Kivu, Rwanda - Sediment site 10cm | Environmental | Open in IMG/M |
3300013131 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_10m | Environmental | Open in IMG/M |
3300013132 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_9.5m | Environmental | Open in IMG/M |
3300013137 (restricted) | Freshwater microbial communities from Kabuno Bay, South-Kivu, Congo ? kab_092012_11.1m | Environmental | Open in IMG/M |
3300014819 | Freshwater microbial communities from Lake Lanier in Georgia, USA - LL_1011A | Environmental | Open in IMG/M |
3300016743 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071413AT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300016771 | Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 071412BT metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300017818 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101401AT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300017824 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 011501BT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300017949 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071406AT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300017951 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101413BT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300017952 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071405CT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300017956 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071403BT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300017958 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071405AT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300017962 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071404AT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300017967 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071411BT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300017968 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071409AT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300017969 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071407BT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300017985 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101412BT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300018039 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071402CT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300018421 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412BT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300018424 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412AT metaG (megahit assembly) | Environmental | Open in IMG/M |
3300019708 | Sediment microbial communities from the Broadkill River, Lewes, Delaware, United States ? BRC_2-3_MG | Environmental | Open in IMG/M |
3300019756 | Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW6Sep16_MG | Environmental | Open in IMG/M |
3300019765 | Freshwater microbial communities from the Broadkill River, Lewes, Delaware, United States ? IW13Sep16_MG | Environmental | Open in IMG/M |
3300020074 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015017 Mahale Deep Cast 200m | Environmental | Open in IMG/M |
3300020083 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015033 Kigoma Deep Cast 300m | Environmental | Open in IMG/M |
3300020084 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015032 Kigoma Deep Cast 1200m | Environmental | Open in IMG/M |
3300020109 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015016 Mahale Deep Cast 400m | Environmental | Open in IMG/M |
3300020141 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_104 megahit1 | Environmental | Open in IMG/M |
3300020151 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_202 megahit1 | Environmental | Open in IMG/M |
3300020159 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_108 megahit1 | Environmental | Open in IMG/M |
3300020172 | Freshwater lake microbial communities from Lake Erken, Sweden - P4710_102 megahit1 | Environmental | Open in IMG/M |
3300020179 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015056 Kigoma Offshore 0m | Environmental | Open in IMG/M |
3300020183 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015002 Mahale S4 surface | Environmental | Open in IMG/M |
3300020189 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071401CT metaG (spades assembly) | Environmental | Open in IMG/M |
3300020190 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015013 Mahale N5 surface | Environmental | Open in IMG/M |
3300020196 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015031 Kigoma Deep Cast 0m | Environmental | Open in IMG/M |
3300020222 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015034 Kigoma Deep Cast 250m | Environmental | Open in IMG/M |
3300020488 | Freshwater microbial communities from Lake Mendota, WI - 17OCT2008 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020498 | Freshwater microbial communities from Lake Mendota, WI - 13JUN2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020547 | Freshwater microbial communities from Lake Mendota, WI - 05AUG2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020570 | Freshwater microbial communities from Lake Mendota, WI - 31AUG2010 deep hole epilimnion (SPAdes) | Environmental | Open in IMG/M |
3300020578 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015038 Kigoma Deep Cast 35m | Environmental | Open in IMG/M |
3300020603 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015035 Kigoma Deep Cast 150m | Environmental | Open in IMG/M |
3300021091 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015055 Kigoma Offshore 40m | Environmental | Open in IMG/M |
3300021335 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO540 | Environmental | Open in IMG/M |
3300021356 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO245 | Environmental | Open in IMG/M |
3300021368 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO550 | Environmental | Open in IMG/M |
3300021373 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO282 | Environmental | Open in IMG/M |
3300021376 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015050 Kigoma 12 surface | Environmental | Open in IMG/M |
3300021424 | Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015009 Mahale N1 surface | Environmental | Open in IMG/M |
3300021425 | Coastal seawater microbial communities near Pivers Island, North Carolina, United States - PICO284 | Environmental | Open in IMG/M |
3300021959 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_13D | Environmental | Open in IMG/M |
3300021960 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_9D | Environmental | Open in IMG/M |
3300021961 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_3D | Environmental | Open in IMG/M |
3300021962 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_649D | Environmental | Open in IMG/M |
3300021963 | Estuarine water microbial communities from San Francisco Bay, California, United States - C33_657D | Environmental | Open in IMG/M |
3300022050 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (v3) | Environmental | Open in IMG/M |
3300022176 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v2) | Environmental | Open in IMG/M |
3300022179 | Freshwater viral communities from Lake Michigan, USA - Fa13.VD.MLB.D.N | Environmental | Open in IMG/M |
3300022187 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Sep_01 (v3) | Environmental | Open in IMG/M |
3300022198 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (v3) | Environmental | Open in IMG/M |
3300022200 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v3) | Environmental | Open in IMG/M |
3300022752 | Freshwater microbial communities from Lake Lanier, Atlanta, Georgia, United States - LL_1208_BB | Environmental | Open in IMG/M |
3300022934 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101413BT metaG | Environmental | Open in IMG/M |
3300022935 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071405AT metaG | Environmental | Open in IMG/M |
3300023081 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071406AT metaG | Environmental | Open in IMG/M |
3300023084 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071405CT metaG | Environmental | Open in IMG/M |
3300023116 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412BT metaG | Environmental | Open in IMG/M |
3300023170 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071407BT metaG | Environmental | Open in IMG/M |
3300023176 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071411BT metaG | Environmental | Open in IMG/M |
3300023180 | Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 071412AT metaG | Environmental | Open in IMG/M |
3300024348 | 0.2um to 3um size fraction coassembly | Environmental | Open in IMG/M |
3300024480 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Cont_RepC_0h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300025585 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_0.19_D_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025610 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_D_<0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025630 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025646 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1S Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
3300025653 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_29_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025655 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
3300025671 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (SPAdes) | Environmental | Open in IMG/M |
3300025674 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
3300025687 | Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG (SPAdes) | Environmental | Open in IMG/M |
3300025771 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_N_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025840 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Sum_22_D_>0.8_DNA (SPAdes) | Environmental | Open in IMG/M |
3300025889 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes) | Environmental | Open in IMG/M |
3300026085 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S23_td_SurfaceB_ad_5m_LV_B (SPAdes) | Environmental | Open in IMG/M |
3300026837 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T2_25-Nov-14 (SPAdes) | Environmental | Open in IMG/M |
3300027152 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepB_8d | Environmental | Open in IMG/M |
3300027393 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T4_4-Nov-14 (SPAdes) | Environmental | Open in IMG/M |
3300027597 | Freshwater microbial communities from Columbia River, Oregon, United States - Colum_Miss_RepB_8d | Environmental | Open in IMG/M |
3300027693 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (6) Depth 1-3cm September2015 (SPAdes) | Environmental | Open in IMG/M |
3300027721 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 10-12cm May2015 (SPAdes) | Environmental | Open in IMG/M |
3300027792 | Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 1-3cm May2015 (SPAdes) | Environmental | Open in IMG/M |
3300027816 | Freshwater lake microbial communities from Lake Erie, under a cyanobacterial bloom - NOAA_Erie_Diel5S_2200h metaG (SPAdes) | Environmental | Open in IMG/M |
3300027917 | Marine sediment microbial communities from White Oak River estuary, North Carolina - WOR-2-8_12 (SPAdes) | Environmental | Open in IMG/M |
3300027940 | Groundwater microbial communities from the Columbia River, Washington, USA, for microbe roles in carbon and contaminant biogeochemistry - GW-RW metaG T3_25-Nov-14 (SPAdes) | Environmental | Open in IMG/M |
3300029699 | Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Colum_RepB_8h (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300029930 | Aquatic microbial communities from drinking water treatment plant in Pearl River Delta area, China - influent_20120727 | Environmental | Open in IMG/M |
3300029932 | Freshwater microbial communities from drinking water treatment plant - The University of Hong Kong - Raw_water_201207A | Environmental | Open in IMG/M |
3300031578 | Soil microbial communities from Risofladan, Vaasa, Finland - TR-2 | Environmental | Open in IMG/M |
3300031758 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA123 | Environmental | Open in IMG/M |
3300031784 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 4 MA112 | Environmental | Open in IMG/M |
3300031857 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA125 | Environmental | Open in IMG/M |
3300031951 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 12 MA120 | Environmental | Open in IMG/M |
3300032050 | Freshwater fungal communities from buoy surface, Lake Erie, Ohio, United States - Buoy 2 MA122 | Environmental | Open in IMG/M |
3300033521 | Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M1_C1_D1_B | Environmental | Open in IMG/M |
3300033978 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME28Sep2014-rr0002 | Environmental | Open in IMG/M |
3300033979 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME30Aug2017-rr0003 | Environmental | Open in IMG/M |
3300033994 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME25Jul2006D11-rr0046 | Environmental | Open in IMG/M |
3300034012 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME18Aug2017-rr0027 | Environmental | Open in IMG/M |
3300034072 | Fracking water microbial communities from deep shales in Oklahoma, United States - MC-3-A | Environmental | Open in IMG/M |
3300034073 | Fracking water microbial communities from deep shales in Oklahoma, United States - MC-6-XL | Environmental | Open in IMG/M |
3300034102 | Freshwater microbial communities from Lake Mendota, Madison, Wisconsin, United States - TYMEFLIES-ME17Jul2002-rr0112 | Environmental | Open in IMG/M |
3300034418 | Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v4) | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
DelMOSpr2010_100832794 | 3300000116 | Marine | MNLSEFIEEFRESEIYETDPQDWRGYLAEDDYWVPDPELVY* |
DelMOSpr2010_100850722 | 3300000116 | Marine | MDLSELIDELREIKIYETDPKDWMGVLEEDDYWEVETELVY* |
DelMOSpr2010_101607091 | 3300000116 | Marine | MDLSELIDEIREIKIYETDPKDWMGVLEEDDYWEVATELV |
JGIcombinedJ13530_1077584061 | 3300001213 | Wetland | VNFMDLSEILDEIREIEIYDVDPKDWMGYLKEDDFWDPVPELAY* |
B570J13889_1005531 | 3300001255 | Freshwater | MDLSELIDELREIAMYESDPQDWMGYLGDDEPWVPDSELAY* |
ACM19_1020342 | 3300001818 | Marine Plankton | MDLSELIEELREIEIYDTDPQDWMGYLKEDDYWVTDPELAY* |
ACM36_1111442 | 3300001824 | Marine Plankton | MDLSELIEELREIEIYDTDPQDWMGYLKEDDYWVPDPELVY* |
ACM20_1133621 | 3300001826 | Marine Plankton | MDLSEMLEEIREIEIYDTDPKDWMCYLREDDYWELAP* |
ACM21_10240395 | 3300001827 | Marine Plankton | MDLSELIEEFREIEIYDTDPQDWMGYLKEDDYWVPDAELVY* |
ACM3_10015955 | 3300001828 | Marine Plankton | MDLSEMLEEIREIEIYDTDPKDWMGYLREDDYWELAPEFVY* |
ACM40_10146561 | 3300001830 | Marine Plankton | MDLSELIEELREIEIYETDPQDWMGYLKEDDYWETVPELVY* |
GOS2237_10501273 | 3300001955 | Marine | MDLSELIDELREIAIYETDPQDWMGYLENDDYWVPDTELAY* |
GOS2236_10356853 | 3300001968 | Marine | MLDELREIAMYETDPQDWMGYLENDDYWVPDPELAY* |
GOS2236_10357563 | 3300001968 | Marine | MDLSELIDEVREIEIYNTDPQDWMGYLYDDDYWVPDHELAY* |
GOS2236_10583858 | 3300001968 | Marine | MNLSELIEEFREIDLYDADPQDWMNYLESDDYYVPSHELAY* |
GOS2236_10663195 | 3300001968 | Marine | MDLSELIDELREIAMYESDPQDWMGYLEDDDSWVPDSELAY* |
GOS2236_10697355 | 3300001968 | Marine | LMDLSELIDELREIAIYETDPQDWMGYLENDDYWVPDSELAY* |
GOS2236_10900193 | 3300001968 | Marine | MDLSEMIDELREIAIYDTDPQDWMGYLADDDYWVPDTELAY* |
B570J40625_10001534234 | 3300002835 | Freshwater | MDLSELIEELREIEIYGSEPADWMGYLYDDDSWVPDHELAY* |
Ga0007787_100659301 | 3300004240 | Freshwater Lake | MDLSELIEELREIEIYGSEPADWMGFLGDDEPWVPDSELAY* |
Ga0007787_101850252 | 3300004240 | Freshwater Lake | MDLSELIDEIREIEIYGSEPADWMGYLGDDEPWVPDSELAY* |
Ga0069718_112104993 | 3300004481 | Sediment | LLMDLSELIDEFREITLYDYNPQDWMGYLESDDYWVPDHELAY* |
Ga0069718_156323554 | 3300004481 | Sediment | MNSVELSELIDEIREIEIYRNDPQDWMNYLDSDDYYVPDTELAY* |
Ga0068876_1000049842 | 3300005527 | Freshwater Lake | MDLSEILDEIREIEIYDVDPKDWMGYMKEDDSWDPVPELAY* |
Ga0068876_100045462 | 3300005527 | Freshwater Lake | MNLSELIEELREIEIYETDPQDWMGYLKDDSTWVPDVELAY* |
Ga0068876_1002950210 | 3300005527 | Freshwater Lake | MDLSELIDELREIKMYETDPQDWMGYLEEDDYWDPVRELAY* |
Ga0068876_101104083 | 3300005527 | Freshwater Lake | MDLSELIEELREIEIYGSEPSDWMGYMGSDDYWVDPSVPDQELAY* |
Ga0068876_101801382 | 3300005527 | Freshwater Lake | MDLSELIEELREIEIYGSEPADWMGYLYDDDFWVPDHELAY* |
Ga0068876_102365622 | 3300005527 | Freshwater Lake | MDLSELIDELREIALYESDPQDWMGYLENDDYWVPDPELAY* |
Ga0049081_100412304 | 3300005581 | Freshwater Lentic | MDLSELIEELREIEIYGSEPADWMGYLCDDDSWVPDSELAY* |
Ga0078894_100938593 | 3300005662 | Freshwater Lake | MFSIELSELIDEIREIEIYGQDPQDWMGILESDDHWGTDRELAY* |
Ga0076948_103609017 | 3300005739 | Lake Water | MNSVELSELIDEIREIELYDTDPADWMGYLDDDNHYVPDVELAY* |
Ga0079957_100006033 | 3300005805 | Lake | MNLTELIEEIREIEIYGSDPADWMGYLGSDDYWVPDEELAY* |
Ga0079957_10031402 | 3300005805 | Lake | MDLSELIEEFREIALYDSDPQDWMGILESDDYWVPDQELAY* |
Ga0079957_10932532 | 3300005805 | Lake | MDLSELLDELREIEIYDTDPKDWMGYLKEDDSWDPVPELAY* |
Ga0079957_11772463 | 3300005805 | Lake | MDLSELIDEIREIEIYGSEPADWMGYLCDDEPWVPDSELAY* |
Ga0079957_12637762 | 3300005805 | Lake | MDLSELIDEIREIKIYETDPQDWMGVLEEDDYWDPVTELAY* |
Ga0066377_1000169312 | 3300005934 | Marine | MDLSELIEEFRESEIYETDPQDWMGYLKSDDYWVPDPELVY* |
Ga0066377_101780632 | 3300005934 | Marine | MDLSELIDELREIKIYETDPQDWMGVLEEDDYWETVPELVY* |
Ga0066377_101909352 | 3300005934 | Marine | MDLSELIEEFRENEIYDTNPQDWMGYLFEDDYYVPDVELAY* |
Ga0073913_100013914 | 3300005940 | Sand | MDLSELIEELREIEIYGSEPADWMGYLCDDEPWVPDSELAY* |
Ga0073913_100022256 | 3300005940 | Sand | MDLSELIDEVREIALYETDPQDWMGYLEDDRIWVPDPELVY* |
Ga0073913_100040723 | 3300005940 | Sand | MDLSELIDEFREITLYDYDPQDWMGYLESDDYWVPDHELAY* |
Ga0073926_100947521 | 3300005943 | Sand | RVFCYNIKVVALHPMDLSELIDEVREIALYETDPQDWMGYLEDDRIWVPDPELAY* |
Ga0075474_101675242 | 3300006025 | Aqueous | MNLSEFIEEFRESEIYETDPQDWRGYLADDDYWLPDPELVY* |
Ga0075474_102003132 | 3300006025 | Aqueous | MDLSELIDEIREIKIYETDPKDWMGVLEEDDYYWEVATELVY* |
Ga0075478_100461376 | 3300006026 | Aqueous | KQLEGYSMDLSELIDEIREIKIYETDPKDWMGVLEEDDYWEVATELVY* |
Ga0075470_100015604 | 3300006030 | Aqueous | MDLSELIEELREIEIYGSEPSDWMGYLGSDDYWVPDEELAY* |
Ga0075461_100420581 | 3300006637 | Aqueous | TIIKQLEGYSMDLSELIDEIREIKIYETDPKDWMGVLEEDDYYWEVATELVY* |
Ga0075461_100465214 | 3300006637 | Aqueous | MDLSELIDEIREIKIYETDPKDWMGVLEEDDYWEVATELVY* |
Ga0079301_10706052 | 3300006639 | Deep Subsurface | MFSVELSELIDEIREIEIYGSEPADWMGYLGDDDSYVPDSELAY* |
Ga0070749_106332971 | 3300006802 | Aqueous | KQLEGYSMDLSELIDEIREIKIYETDPQDWMGVLEEDDYWDPVPELAY* |
Ga0070749_107246452 | 3300006802 | Aqueous | MDLSELIDEIREIKIYETDPQDWMGVLEEDDYWETVPELVY* |
Ga0070754_101982443 | 3300006810 | Aqueous | MNLSEFIEEFREHEIYETDPQDWRGYLADDDYWVPDPELVY* |
Ga0070754_102501582 | 3300006810 | Aqueous | MDLSELIDELREIKIYETDPKDWMGVLEDDDYWEVATELVY* |
Ga0070754_102529902 | 3300006810 | Aqueous | MDLSELIDEIREIKIYETDPQDWMGVLEEDDYWDPVPELAY* |
Ga0070754_103268083 | 3300006810 | Aqueous | MNLSEFIEEFRESEIYETDPQDWRGYLADDDYWVPDPELVY* |
Ga0075481_102024352 | 3300006868 | Aqueous | MDLSELIDELREIRIYETDPQDWMGVLEEDDYWDPVPELAY* |
Ga0075479_103114102 | 3300006870 | Aqueous | SPPYATITKQLEGYSMDLSELIDEIREIKIYETDPQDWMGVLEEDDYWDPVPELAY* |
Ga0103961_12819312 | 3300007216 | Freshwater Lake | MDLSELIDELREIAMYETDPQDWMGYLENDDYWVPDSELAY* |
Ga0075460_102572661 | 3300007234 | Aqueous | RPHYATIIKQLEGYSMDLSELIDEIREIKIYETDPKDWMGVLEEDDYWEVATELVY* |
Ga0099851_10740601 | 3300007538 | Aqueous | MDLSELIDELREIKIYETDPQDWMGVLEEDDYWDPVPEL |
Ga0099851_11218914 | 3300007538 | Aqueous | SMDLSELIDELREIKIYETDPQDWMGVLEEDDYWDPVPELAY* |
Ga0099851_11349763 | 3300007538 | Aqueous | MDLSELIDELREIKIYETDPQDWMNVLEEDDYWDPVVELAY* |
Ga0099851_11935662 | 3300007538 | Aqueous | MNLTELIEEIREIDIYGSDPVDWMGYLANDDYWVPDEELAY* |
Ga0099851_13590132 | 3300007538 | Aqueous | MDLSELIDELREIKIYETDPQDWMGVLEEDDYWDPVTELAY* |
Ga0099849_10006338 | 3300007539 | Aqueous | MNLTEFIEEIREIEIYGSDPVDWMGYLANDDYWVPDEELVY* |
Ga0099849_10031582 | 3300007539 | Aqueous | MDLSELLDELREIKIYETDPKDWMGVLEEDDYWETVPELVY* |
Ga0099849_100381220 | 3300007539 | Aqueous | MNPIELSELIEEFREITLYDTNPQDWMGYLESDDYWEVNKELVY* |
Ga0099849_10167643 | 3300007539 | Aqueous | MDLSELIEELREIEIYDTDPQDWMGYLKEDDYWEVATELVY* |
Ga0099849_10288764 | 3300007539 | Aqueous | MDLSELIDEIREIKIYETDPKDWMGVLEEDDYWDPVTELAY* |
Ga0099849_11033211 | 3300007539 | Aqueous | MDLSELIDELREIRIYETDPKDWMGVLEEDDYWEVATELVY* |
Ga0099849_11102563 | 3300007539 | Aqueous | MDLSELIDELREIKIYETDPKDWMGVLEEDDYWLPDPELVY* |
Ga0099849_11560542 | 3300007539 | Aqueous | MFAVELSELIDEIREIEIYKTDPQDWMGVLEDDDYWEVATELVY* |
Ga0099849_11613452 | 3300007539 | Aqueous | MFSVELSELIDEIREIEIYGSEPADWMGYLESDDWWEVNKELVY* |
Ga0099849_12590212 | 3300007539 | Aqueous | MDLSELIEEFRESELYETDPQDWMGYLKEDDYWLPDPEFVY* |
Ga0099849_12644743 | 3300007539 | Aqueous | DELREIKIYETDPQDWMGVLEEDDYWDPVPELAY* |
Ga0099848_12439812 | 3300007541 | Aqueous | PYATIIKQLEGLLMDLSELIDEIREIKIYETDPQDWMGVLEEDDYWDPVTELAY* |
Ga0099848_12845502 | 3300007541 | Aqueous | MDLSEILDEIREIEIYDVDPKDWMGYLKEDDSWDPVPELAY* |
Ga0099848_12872291 | 3300007541 | Aqueous | MNSVELSELIEEFREHKFYDTNPQDWMGYLESDDWWEPVAELAY* |
Ga0099846_12979862 | 3300007542 | Aqueous | MGLSELLDELREIKIYENDPQDWMGVLEDDDFWTTDKELIY* |
Ga0102861_12253572 | 3300007544 | Estuarine | IMDLSELIEELREIEIYGSEPADWMGYLENDDYWVPDHELAY* |
Ga0102903_12294692 | 3300007630 | Estuarine | MDLSELIDEIREIKIYETDPQDWMGVLEDDDYWDPVPELAY* |
Ga0070751_11602103 | 3300007640 | Aqueous | EEFRESEIYETDPQDWRGYLAEDDYWVPDPELVS* |
Ga0102862_10219123 | 3300007670 | Estuarine | MDLSELIEELREIEIYGSEPADWMGYLENDDYWVPDHELAY* |
Ga0104988_11027194 | 3300007735 | Freshwater | MDLSELIDELREISMYETDPQDWMGYLENDDYWVPDSELAY* |
Ga0099850_10182582 | 3300007960 | Aqueous | MDLSELIDEIREIKIYETDPQDWMGVLEEDDYWDPITELAY* |
Ga0099850_12474231 | 3300007960 | Aqueous | VVEDLSMNLTELIEEIREIDIYGSDPVDWMGYLANDDYWVPDEELAY* |
Ga0099850_13172331 | 3300007960 | Aqueous | FMDLSELIDELREIKIYETDPKDWMGVLEEDDYWEVATELVY* |
Ga0099850_13907553 | 3300007960 | Aqueous | MNSVELSELIEEFREHKFYDTNPQDWMGVLEDDDWWDPVAELAY* |
Ga0108970_105570973 | 3300008055 | Estuary | MDLSELIDELREIEIYGSEPSDWMGYMGSDDYWVPDEELAY* |
Ga0114338_10805043 | 3300008105 | Freshwater, Plankton | MDLSELIDELREIALYDTDPQDWMGYLENDDYWVPDPELAY* |
Ga0114340_100042357 | 3300008107 | Freshwater, Plankton | MDLSELIEELREIEIYGSEPSDWMGYMGSDDYWVPDSELAY* |
Ga0114340_10522381 | 3300008107 | Freshwater, Plankton | MDLSELIEELREIEIYGSEPADWMGYLCDDEPWVPDPELAY* |
Ga0114346_11415783 | 3300008113 | Freshwater, Plankton | MDLSELLDEIREIEIYGNDPADWMGYLKEDDSWDPVPELAY* |
Ga0114355_10291248 | 3300008120 | Freshwater, Plankton | GSFMDLSELIDELREIKMYETDPHDWMGYLEEDDYWDPVRELAY* |
Ga0114363_10713555 | 3300008266 | Freshwater, Plankton | DELREIALYESDPQDWMGYLENDDYWVPDPELAY* |
Ga0114876_100033571 | 3300008448 | Freshwater Lake | MNLTELIEEIREIEIYGSDPVDWMGYLSSDDYWVPDEELAH* |
Ga0102960_12246013 | 3300009000 | Pond Water | SMDLSELIDEIREIKIYETDPQDWMGVLEEDDYWETVPELVY* |
Ga0102963_13770252 | 3300009001 | Pond Water | MDLSELIDELREIKIYETDPQDWMGVLEEDDYWDPVPELAY* |
Ga0105105_106568361 | 3300009009 | Freshwater Sediment | MNSTELSELIDEIREIEIYGQDPQDWMNYLESDDYYVPDHELAY* |
Ga0105103_100320315 | 3300009085 | Freshwater Sediment | MNSTELSELIDEIREIEIYRSNPQDWMNYLDSDDHYEPDHELAY* |
Ga0118687_103088151 | 3300009124 | Sediment | ELIDEIREIKIYETDPKDWMGVLEDDDYWEVATELVY* |
Ga0105091_100222166 | 3300009146 | Freshwater Sediment | MNSVELSELIDEIREIEIYRSNPQDWMNYLDSDDHYEPDHELAY* |
Ga0105091_100883963 | 3300009146 | Freshwater Sediment | SELIDEIREIEIYRSNPQDWMNYLDSDDHYEPDHELAY* |
Ga0105102_104421153 | 3300009165 | Freshwater Sediment | NSVELSELIDEIREIEIYRSNPQDWMNYLDSDDHYEPDHELAY* |
Ga0105097_104301532 | 3300009169 | Freshwater Sediment | MDLSEFLDELREIAIYNIDPKDWMGILESDDYWVSDTELAH* |
Ga0103848_10286361 | 3300009218 | River Water | MDLSELIDEVREIEIYNTDPQDWMGYLENDDYWVPDTELAY* |
Ga0103824_1009855 | 3300009331 | River Water | EEFRESEIYETDPQDWRGYLADDDYWLPDPELVY* |
Ga0103826_1008845 | 3300009338 | River Water | MDLSEMLEEIREIEIYDTDPKDWMGYLREDDYWELAPELVY* |
Ga0103826_1010132 | 3300009338 | River Water | MDLSELIDELREIKIYETDPKDWMGVLEEDDYWEVATELVY* |
Ga0103826_1016652 | 3300009338 | River Water | MDLSELIEEFREHELYETNPHDWMGYLKEDDYWVPDSELVY* |
Ga0129348_10602474 | 3300010296 | Freshwater To Marine Saline Gradient | MDLSELLDELREIKIYETDPKDWMGVLEEDDYWEVATELVY* |
Ga0129348_12733471 | 3300010296 | Freshwater To Marine Saline Gradient | MDLSELIDELREIKIYETDPKDWMGVLEEDDYWDPVTELAY* |
Ga0129345_10069243 | 3300010297 | Freshwater To Marine Saline Gradient | MFSVELSELIDEIREIEIYGSEPADWMGYLGSDDYYVPDHELVY* |
Ga0129345_10481183 | 3300010297 | Freshwater To Marine Saline Gradient | MFAVELSELIDEIREIEIYNTDPQDWMGVLEDDDYWEVATELVY* |
Ga0129345_12371611 | 3300010297 | Freshwater To Marine Saline Gradient | MDLSELIDELREIKIYETNPKDWMGVLEDDDYWEVATELVY* |
Ga0129345_13561641 | 3300010297 | Freshwater To Marine Saline Gradient | MDLSELINELREIKIYETDPKDWMGVLEEDDYWEVATEFVY* |
Ga0129342_10465553 | 3300010299 | Freshwater To Marine Saline Gradient | MNPIELSELIEEFREITLYDTNPQDWIGYLESDDYWEVNKELVY* |
Ga0129342_11872883 | 3300010299 | Freshwater To Marine Saline Gradient | EGYSMDLSELIDEIREIKIYETDPKDWMGVLEDDDYWETVPELVY* |
Ga0129342_12080272 | 3300010299 | Freshwater To Marine Saline Gradient | VDLSELLEEFRESEIYNSDPQDWMGYLKEDDYWVPDVELVY* |
Ga0129342_12534053 | 3300010299 | Freshwater To Marine Saline Gradient | LSELIDEIREIKIYETDPKDWMGVLEEDDYWDPVTELAY* |
Ga0129351_10215246 | 3300010300 | Freshwater To Marine Saline Gradient | PHYATIIKQLEGYSMDLSELIDEIREIKIYETDPKDWMGVLEEDDYWDPVTELAY* |
Ga0129351_10667623 | 3300010300 | Freshwater To Marine Saline Gradient | MDLSELIDELREIRIYETDPKDWMGVLEEDDYWDPVPELAY* |
Ga0129351_12800343 | 3300010300 | Freshwater To Marine Saline Gradient | MDLSEMLEELREIKIYETDPKDWMGVLEEEDYWDVATELVY* |
Ga0136656_10363614 | 3300010318 | Freshwater To Marine Saline Gradient | DEIREIKIYETDPKDWMGVLEEDDYWDPVTELAY* |
Ga0136656_11227952 | 3300010318 | Freshwater To Marine Saline Gradient | MDLSELIDEVREIALYDSDPQDWMGYLESDDWWVPDSELAY* |
Ga0136656_12649411 | 3300010318 | Freshwater To Marine Saline Gradient | MDLSELIDEIREIKIYETDPKDWMGVLEEDDYWDPVVELAY* |
Ga0129333_1000003946 | 3300010354 | Freshwater To Marine Saline Gradient | MDLSELIEELREIEIYGSDPVDWMGYLYDDDYWVPDTELAY* |
Ga0129333_1002930510 | 3300010354 | Freshwater To Marine Saline Gradient | MNLTELIEEIREIEIYGSDPADWMGYLENDDYWVPDYELAY* |
Ga0129333_100428976 | 3300010354 | Freshwater To Marine Saline Gradient | MDLSELIDELREIEIYGSEPADWMGYMGEDDSWVPDHELAY* |
Ga0129333_100894194 | 3300010354 | Freshwater To Marine Saline Gradient | MDLSELIEELREIEIYGSEPSDWMGYLENDDYWVPDPELAY* |
Ga0129333_100920234 | 3300010354 | Freshwater To Marine Saline Gradient | MDLSELIDEIREIEIYGSDPLDWMGVLEEDDYWDPVTELAY* |
Ga0129333_101082894 | 3300010354 | Freshwater To Marine Saline Gradient | MDLSELIDELREIAMYESDPQDWMGYLENDDSWVPDSELAY* |
Ga0129333_101167136 | 3300010354 | Freshwater To Marine Saline Gradient | MDLSELIDEVREINLYDSDPQDWMGYLENDDYWVPDPELAY* |
Ga0129333_101672153 | 3300010354 | Freshwater To Marine Saline Gradient | MFAVELSELIDEIREIEIYNTDPQDWMNYLETDDYYVPDHELVY* |
Ga0129333_101805375 | 3300010354 | Freshwater To Marine Saline Gradient | MDLSELIDEIREIEIYGSEPADWMGYLESDDWWVPDPELAY* |
Ga0129333_101818613 | 3300010354 | Freshwater To Marine Saline Gradient | MDLSELIDEIREIEIYGSDPADWMGVLEEDDYWDPVTELAY* |
Ga0129333_102000761 | 3300010354 | Freshwater To Marine Saline Gradient | MDLSEILDEIREIEIYGNDPADWMGYLKDDDSWDPVPELAY* |
Ga0129333_102518441 | 3300010354 | Freshwater To Marine Saline Gradient | MDLSELMDELREIAMYESDPQDWMGYLENDDSWVPDSELAY* |
Ga0129333_102672774 | 3300010354 | Freshwater To Marine Saline Gradient | GLLMDLSELIDEIREIKIYETDPQDWMGILEEDDYWEPTGELAY* |
Ga0129333_102761313 | 3300010354 | Freshwater To Marine Saline Gradient | MFAVELSELIEEFREITLYDSDPQDWMGILESDDYWVPDHELAY* |
Ga0129333_103582722 | 3300010354 | Freshwater To Marine Saline Gradient | MDLSELIDELREIKMYETDPQDWMGILEDDDYWDPVPELAY* |
Ga0129333_104330841 | 3300010354 | Freshwater To Marine Saline Gradient | MDLSELIDELREIALYESDPQDWMGYLESDDSWVPDSELAY* |
Ga0129333_107100061 | 3300010354 | Freshwater To Marine Saline Gradient | ELIEELREIEIYGSEPADWMGFLGDDEPWVPDSELAY* |
Ga0129333_107526102 | 3300010354 | Freshwater To Marine Saline Gradient | MDLSELIDELREIAMYESDPQDWMGYLENDDYWVPDSELAY* |
Ga0129333_110585531 | 3300010354 | Freshwater To Marine Saline Gradient | MDLSELIDEIREIEIYGSEPADWMGYLYDDDYWVPDSELAY* |
Ga0129333_113711311 | 3300010354 | Freshwater To Marine Saline Gradient | MDLSELIDELREIALYESDPQDWMGYLENDDYWVPDSELAY* |
Ga0129333_115984031 | 3300010354 | Freshwater To Marine Saline Gradient | MDLSEFLDELREIAIYNTDPQDWMGILESDDYRVPDPELAH* |
Ga0129333_117550301 | 3300010354 | Freshwater To Marine Saline Gradient | MDLSELMDELREIAMYESDPQDWMGYLGDDEPWVPDSELAY* |
Ga0129324_102801972 | 3300010368 | Freshwater To Marine Saline Gradient | GSFMDLSELIDELREIKIYETDPQDWMGVLEEDDYWDPVPELAY* |
Ga0129336_104056731 | 3300010370 | Freshwater To Marine Saline Gradient | SPPYATITKQLEGLLMDLSELIDEIREIKIYETDPQDWMGVLEEDDYWDPVPELAY* |
Ga0129336_105454501 | 3300010370 | Freshwater To Marine Saline Gradient | MDLSELLDELREIKIYENDPQDWMGVLEDDDFWTTDKELIY* |
Ga0129336_106986301 | 3300010370 | Freshwater To Marine Saline Gradient | MDLSELIDEIREIKIYETDPQDWMGVLEDDDYWDPVPEPAY* |
Ga0136549_101319741 | 3300010389 | Marine Methane Seep Sediment | MDLSELIDEIREIAIYGTNPEDWMGYVEYDDLDVPDVELAY* |
Ga0136549_103145221 | 3300010389 | Marine Methane Seep Sediment | MDLSEMLEELREIKIYETDPKDWMGVLEEDDYWDPVPELAY* |
Ga0136852_102753484 | 3300010412 | Mangrove Sediment | MDLSELIEEFRENEIYGINPQDWMGYLYEDDYYVPDVELAY* |
Ga0136852_112668171 | 3300010412 | Mangrove Sediment | MDLSEMLDEIREIEIYDTDPQDWMGYLKEDDYWVPDVELAY* |
Ga0139308_1262142 | 3300010996 | Sediment | MNSVELSELIEEFREIDLYETNPQDWMGYLESDDYWVPDSELAY* |
Ga0151517_14638 | 3300011113 | Freshwater | MDLSELIDEVREIALYETDPQDWMGYLEDDRIWVPDPELAY* |
Ga0151620_10012752 | 3300011268 | Freshwater | MDLSELLDELREIAIYETDPQDWMGYLEDDSTWVPDYELAY* |
Ga0151620_10294627 | 3300011268 | Freshwater | MDLSEMLDELREIAIYETDPQDWMGYMENDDYWVPDVELAY* |
Ga0151620_10383985 | 3300011268 | Freshwater | FMDLSEILDEIREIEIYDVDPKDWMGYLKEDDSWDPVPELAY* |
Ga0119951_10054391 | 3300012000 | Freshwater | MDLSELIDELREIAMYETDPQDWMGYMGEDDSWVPDSELAY* |
Ga0129349_14550271 | 3300012518 | Aqueous | KSPKEHWRFSPPYATITKQLEGYSMDLSELIDEIREIKIYETDPKDWMGVLEEDDYWEVATELVY* |
Ga0129344_11280082 | 3300012520 | Aqueous | FMDLSELLDELREIKIYETDPKDWMGVLEEDDYWDPVTELAY* |
Ga0129344_13265191 | 3300012520 | Aqueous | MDLSELIEELREIKIYETDPKDWMGVLEEDDYWEVATELVY* |
Ga0129344_14348582 | 3300012520 | Aqueous | MDLSELIDEIREIKIYETDPQDWMGVLEDDDYWDPVTELAY* |
Ga0129344_14374591 | 3300012520 | Aqueous | MDLSELIDELREIKIYETDPKDWMGVLEEDDYWDPVPELAY* |
Ga0129340_13224771 | 3300012963 | Aqueous | LSELIDEIREIKIYETDPKDWMGVLEEDDYWEVATELVY* |
Ga0129337_11759252 | 3300012968 | Aqueous | MDLSELMDELREIAMYDSDPQDWMGYLGEDDYWVPDPELAY* |
Ga0164292_103501302 | 3300013005 | Freshwater | MDLSELIDELREIAMYESDPQDWMGYLENDDHWVPDSELAY* |
Ga0163212_11207262 | 3300013087 | Freshwater | MNPIELSELIDELREIAIYETDPQDWMGYLESDDYWVPDRELAH* |
Ga0163212_11846061 | 3300013087 | Freshwater | MNPVELSELIDELREIAIYETDPQDWMGYLGDDNYYVPDRELAY* |
Ga0163212_12852752 | 3300013087 | Freshwater | MNPVELSELIDELREIAIYETDPQDWMGYLESDDYWVPDRELAH* |
(restricted) Ga0172368_102838961 | 3300013123 | Freshwater | MDLSELIDELRESAIYGTDPQDWMGYLESDDYWVPDRELAH* |
(restricted) Ga0172367_101588833 | 3300013126 | Freshwater | MDLSELIDEVREIALYDSDPQDWMGYLESDDYWVPDRELAY* |
(restricted) Ga0172367_102825822 | 3300013126 | Freshwater | MDLSELIEELREIEIYGSEPADWMGYLENDDYWVPDIELAY* |
(restricted) Ga0172367_104853541 | 3300013126 | Freshwater | MNSFELSELIDEVREIEIYGSDPQDWMGYLEDDNSYVPDVELAH* |
(restricted) Ga0172365_101349134 | 3300013127 | Sediment | MNPVELSELIDELREIAIYETDPQDWMGYLENDDYWVPDRELAH* |
(restricted) Ga0172364_100461147 | 3300013129 | Sediment | MNPVELSELIDELREIAIYETDPQDWMGYLESDDYWVPDRELVH* |
(restricted) Ga0172373_101467736 | 3300013131 | Freshwater | ELPMNPVELSELIDELREIAIYETDPQDWMGYLENDDYWVPDSELAY* |
(restricted) Ga0172372_100422513 | 3300013132 | Freshwater | MDLSELIDELRESAIYETDPQDWMGYLESDDYWVPDRELAH* |
(restricted) Ga0172375_108563791 | 3300013137 | Freshwater | MDLSELIDEVREIALYDSDPQDWMGYLESDDYWVPDRELAH* |
Ga0119954_100110915 | 3300014819 | Freshwater | MDLSELIDELREIAIYESDPQDWMGYMETDDFLVPDSELAY* |
Ga0182083_10441821 | 3300016743 | Salt Marsh | SELIDEIREIKIYETDPQDWMGVLEEDDYWETLPELVY |
Ga0182082_10208082 | 3300016771 | Salt Marsh | MDLSELIEEFRESEIYNSDPQDWMGYLKEDDYWVPDVELVY |
Ga0181565_1000061246 | 3300017818 | Salt Marsh | MLLRFSMDLSELIEEFREHELHETNPHDWMGYLEDDEAVEELSTIL |
Ga0181565_1001577312 | 3300017818 | Salt Marsh | MNLSEFIEEFRENEIYETDPQDWRGYLEEDDYWLPDPELVY |
Ga0181565_102701642 | 3300017818 | Salt Marsh | MDLSELIDELREIKIYETDPKDWMGVLEEDDYWEVETELVY |
Ga0181565_104753662 | 3300017818 | Salt Marsh | MDLSELIEELREIEIYDTDPQDWMGYLKEDDYWETVPELVY |
Ga0181565_107500802 | 3300017818 | Salt Marsh | MNLSEFIEEFRESEIYETDPQDWRGYLAEDDYWVPDPELVY |
Ga0181552_100289825 | 3300017824 | Salt Marsh | MDLSELIEEFREHELHETNPHDWMGYLEDDEAVEELSTIL |
Ga0181584_100684061 | 3300017949 | Salt Marsh | MDLSELIDELREIKIYETDPKDWMGVLEEDDYWEVATELVY |
Ga0181584_100905385 | 3300017949 | Salt Marsh | MDLSELIEELREIEIYDTDPQDWMGYLKEDDYWVPDVELVY |
Ga0181584_101076921 | 3300017949 | Salt Marsh | SMDLSELIDEIREIKIYETDPKDWMGVLEEDDYWEVATELVY |
Ga0181584_101165002 | 3300017949 | Salt Marsh | MDLSELIDEIREIKIYETDPQDWMGVLEEDDYWETVPELVY |
Ga0181584_101404782 | 3300017949 | Salt Marsh | MDLSELIEEFREHELYETNPHDWMGYLWEDDGYVPDVELAY |
Ga0181584_102428491 | 3300017949 | Salt Marsh | EFIEEFRESEIYETDPQDWRGYLAEDDYWVPDPELVY |
Ga0181584_106774491 | 3300017949 | Salt Marsh | MDLSELIDELREIKIYETDPKDWMGVLEEDDYWDPVTELAY |
Ga0181584_108557462 | 3300017949 | Salt Marsh | DQMDLSELIDEIREIEIYGTNPNDWMGYLGSDEFYQYDLELAY |
Ga0181577_100860701 | 3300017951 | Salt Marsh | MDLSELLEDFRESEIYNSDPQDWMGYLKEDDYWVPDPELVY |
Ga0181583_103748862 | 3300017952 | Salt Marsh | VDLSELLEEFRESEIYNSDPQDWMGYLKEDDYWVPDVELVY |
Ga0181583_104624671 | 3300017952 | Salt Marsh | MDLSELIEELREIEIYETDPQDWMGYLKEDDYWVPDLEYVY |
Ga0181580_102381772 | 3300017956 | Salt Marsh | MDQMDLSELIDEIREIEIYGTNPNDWMGYLGSDEFYQYDLELAY |
Ga0181580_102707012 | 3300017956 | Salt Marsh | MDLSELIEEFRESEIYNSDPQDWMGYLKEDDYWVPDPELVY |
Ga0181580_104711311 | 3300017956 | Salt Marsh | LSELIDEIREIKIYETDPQDWMGVLEEDDYWETVPELVYXPARGV |
Ga0181580_104766882 | 3300017956 | Salt Marsh | MDLSELIDELREIKIYETDPQDWMGVLEEDDYWDPVPELA |
Ga0181580_104990971 | 3300017956 | Salt Marsh | MDLSEMLEELREIKIYETDPKDWMGVLEEDDYWDPVPELAY |
Ga0181580_106184342 | 3300017956 | Salt Marsh | NVAEVFPMDLSELIEELREIEIYDTDPQDWMGYLKEDDYWVPDVELVY |
Ga0181580_107426781 | 3300017956 | Salt Marsh | VAEVFPMDLSELIEELREIEIYDTDPQDWMGYLKEDDYWETVPELVY |
Ga0181580_107934652 | 3300017956 | Salt Marsh | LIEEFRESEIYETDPQDWMGYLKSDDYWVPDPELVY |
Ga0181582_108490981 | 3300017958 | Salt Marsh | DLSELLDELREIKIYETDPKDWMGVLEEDDYWEVATELVY |
Ga0181582_108515822 | 3300017958 | Salt Marsh | IISNVAEVFPMDLSELIEELREIEIYDTDPQDWMGYLKEDDYWETVPELVY |
Ga0181582_109059042 | 3300017958 | Salt Marsh | IISNVAEVFPMDLSELIEELREIEIYDTDPQDWMGYLKEDDYWVPDVELVY |
Ga0181581_106195202 | 3300017962 | Salt Marsh | LIDELREIKIYETDPKDWMGVLEEDDYWDPVTELAY |
Ga0181581_107930493 | 3300017962 | Salt Marsh | IDEIREIKIYETDPKDWMGVLEDDDYWEVATELVY |
Ga0181590_100448159 | 3300017967 | Salt Marsh | MDLSEMLEELREIKIYETDPKDWMGVLEEDDYWEVATELVY |
Ga0181590_104890603 | 3300017967 | Salt Marsh | MDLSELIDELREIKIYETDPQDWMGVLEEDDYWEVATELVY |
Ga0181590_109641491 | 3300017967 | Salt Marsh | IEGYSMDLSELIDEIREIKIYETDPKDWMGVLEEDDYWEVATELVY |
Ga0181587_108311632 | 3300017968 | Salt Marsh | SELIEELREIEIYDTDPQDWMGYLKEDDYWETVPELVY |
Ga0181585_106913142 | 3300017969 | Salt Marsh | LSELIDELREIKIYETDPQDWMGVLEEDDYWDPVPELAY |
Ga0181576_104607032 | 3300017985 | Salt Marsh | MDLSELLEDFRESEIYNSDPQDWMGYLKEDDYWVPDVELVY |
Ga0181576_105624322 | 3300017985 | Salt Marsh | MDLSELIDELREIKIYETDPQDWMGVLEEDDYWDPVTELAY |
Ga0181579_105683852 | 3300018039 | Salt Marsh | MDLSELIDEIREIKIYETDPQDWMGVLEEDDYWETVPELVYXPARGV |
Ga0181592_101076004 | 3300018421 | Salt Marsh | MNLSEFIEEFRENEIYETDPQDWRGYLAEDDYWVPDPELVY |
Ga0181592_102332882 | 3300018421 | Salt Marsh | MDLSELIDELREIKIYETDPQDWMGVLEEDDYWDPVPELVY |
Ga0181592_105134843 | 3300018421 | Salt Marsh | MDLSELIDEIREIKIYETDPQDWMGVLEEDDYWET |
Ga0181592_107475462 | 3300018421 | Salt Marsh | MDLSELIDEIREIKIYETDPKDWMGVLEEDDYWDPVTELAY |
Ga0181591_102166263 | 3300018424 | Salt Marsh | MDLSELIDEIREIKIYETDPQDWMGVLEEDDYWETLPELVY |
Ga0181591_105716461 | 3300018424 | Salt Marsh | DLSELIDELREIKIYETDPKDWMGVLEEDDYWEVETELVY |
Ga0181591_108987723 | 3300018424 | Salt Marsh | SELIDEIREIKIYETDPQDWMGVLEEDDYWETVPELVY |
Ga0194016_10254891 | 3300019708 | Sediment | ELIDEIREIKIYETDPKDWMGVLEDDDYWETVPELVY |
Ga0194023_10479791 | 3300019756 | Freshwater | MNLSEFIEEFRESEIYETDPQDWRGYLAEDDYWVPD |
Ga0194024_10549553 | 3300019765 | Freshwater | EGYSMDLSELIDEIREIKIYETDPKDWMGVLEEDDYWEVATELVY |
Ga0194113_101261492 | 3300020074 | Freshwater Lake | MNSVELSELIDELREIAIYETDPQDWMGYLEDDNHYVPDRELAH |
Ga0194113_101538441 | 3300020074 | Freshwater Lake | ELPMNSIELSELIDELREIAIYETDPQDWMGYLESDDYWVPDWELAH |
Ga0194113_102872702 | 3300020074 | Freshwater Lake | MNPVELSELIDELREIAIYETDPQDWMGYLELDDYWVPDRELAH |
Ga0194113_103431933 | 3300020074 | Freshwater Lake | MNPVELSELLDELREIAIYETDPQDWMGYLESDDYWVPDRELAH |
Ga0194113_105201061 | 3300020074 | Freshwater Lake | ELIDELREIAIYETDPQDWMGYLESDDYWVPDRELAH |
Ga0194113_107789603 | 3300020074 | Freshwater Lake | MNPVELSELIDELREIAIYETDPQDWMGYLGDDNYYVPDRELAH |
Ga0194113_108896592 | 3300020074 | Freshwater Lake | MNPVELSELIDELREIAIYETDPQDWMGYLESDNYWVPDRELAH |
Ga0194113_111040092 | 3300020074 | Freshwater Lake | MNPVELSELIDELREIAIYETDPQDWMGYLESDDYWVPDRELAH |
Ga0194113_111202522 | 3300020074 | Freshwater Lake | MNPIELSELIDELREIAIYETDPQDWMGYLESDDYWVPDRELAH |
Ga0194113_111202541 | 3300020074 | Freshwater Lake | MNSIELSELIDELREIAIYETDPQDWMGYLESDDYWVPD |
Ga0194111_103817191 | 3300020083 | Freshwater Lake | ELSELIDELREIAIYETDPQDWMGYLESDDYWVPDRELAH |
Ga0194111_103871203 | 3300020083 | Freshwater Lake | LSELIDELREIAIYETDPQDWMGYLESDDYWVPDRELAH |
Ga0194110_105345374 | 3300020084 | Freshwater Lake | MNPVELSELIDELREIAIYETDPQDWMGYLESDDYWVPDRELAHR |
Ga0194112_106140732 | 3300020109 | Freshwater Lake | MNPVELSELIDELREIAIYETNPQDWMGYLESDDYWVPDRELAH |
Ga0211732_12344701 | 3300020141 | Freshwater | MNSVELSELIDEIREIEIYRSNPQDWMNYLDSDDHYEPDHELVY |
Ga0211736_102497914 | 3300020151 | Freshwater | MDLSELIDEFREITLYDYDPQDWMGYLESDDYWVPDHE |
Ga0211736_105126932 | 3300020151 | Freshwater | MDLSELIDEFREITLYDYDPQDWMGYLESDDYWVPDHELAY |
Ga0211736_1057295610 | 3300020151 | Freshwater | MNLSEFIEEFREIEIYDTTPEDWMGNLYCDDYWDPDPELAY |
Ga0211736_108207142 | 3300020151 | Freshwater | MFSIELSELIDEIREIEIYGQDPQDWMGILESDDHWGTDRELAY |
Ga0211734_112554406 | 3300020159 | Freshwater | MDLSELIEELREIEIYGSEPSDWMGYMGSDDYWVPDSELAY |
Ga0211729_101574706 | 3300020172 | Freshwater | MNLSELLDELREIEIYGSEPSDWMGYMESDDYWVPDQELAY |
Ga0194134_100516051 | 3300020179 | Freshwater Lake | ITTVEELPMNSVELSELIDEVREIEIYNTDPADWMGYLEDDNSYVPDYELVY |
Ga0194115_100117314 | 3300020183 | Freshwater Lake | MDLSEILDEIREIEIYDVDPKDWMGYLKEDDSWDPVRELAY |
Ga0194115_100144903 | 3300020183 | Freshwater Lake | MDLSELIDELREIAIYEVDPQDWMGYLEEDYYDSNLDLIY |
Ga0194115_1001706312 | 3300020183 | Freshwater Lake | MNSIELSELIDELREIAIYETDPQDWMGYLESDDYWVPDWELAH |
Ga0194115_101873291 | 3300020183 | Freshwater Lake | NPVELSELIDELREIAIYETDPQDWMGYLGDDNYYVPDRELAH |
Ga0194115_103620512 | 3300020183 | Freshwater Lake | MNSVELSELIDELREIAIYETDPQDWMGYLESDDYWVPVPDLAH |
Ga0194115_104254162 | 3300020183 | Freshwater Lake | NPVELSELIDELREIAIYETDPQDWMGYLGDDNYYVPDRELAY |
Ga0194115_104630493 | 3300020183 | Freshwater Lake | MNPVELSELIDELREIAIYETDPQDWMGYLGDDNYYVPDRELA |
Ga0181578_101113615 | 3300020189 | Salt Marsh | MNLSEFIEEFRESEIYETDPQDWRGYLADDDYWVPDPELVY |
Ga0181578_104424321 | 3300020189 | Salt Marsh | SMDLSELIDEIREIKIYETDPKDWMGVLEDDDYWEVATELVY |
Ga0194118_101249294 | 3300020190 | Freshwater Lake | PVELSELIDELREIAIYETDPQDWMGYLESDDYWVPDRELAH |
Ga0194118_103956291 | 3300020190 | Freshwater Lake | MNPVELSELIDELREIAIYETDPQDWMGYLELDDYWVPVPDLAH |
Ga0194124_100657355 | 3300020196 | Freshwater Lake | EELPMNSIELSELIDELREIAIYETDPQDWMGYLESDDYWVPDWELAH |
Ga0194124_105018131 | 3300020196 | Freshwater Lake | MNSIELSELIDELREIAIYETDPQDWMGYLESDDYWVP |
Ga0194125_102550083 | 3300020222 | Freshwater Lake | MNSIELSELIDELREIAIYETDPQDWMGYLESDDYWVPDRELAH |
Ga0208051_1008733 | 3300020488 | Freshwater | MDLSELIDELREIAMYESDPQDWMGYLGDDEPWVPDSELAY |
Ga0208050_10194381 | 3300020498 | Freshwater | ANPMDLSELIDELREIALYESDPQDWMGYLENDDYWVPDPELAY |
Ga0208361_10322232 | 3300020547 | Freshwater | MDLSELIDELREIALYESDPQDWMGYLENDDYWVPDPELAY |
Ga0208465_100002358 | 3300020570 | Freshwater | MDLSELIEELREIEIYGSEPADWMGYLYDDDSWVPDHELAY |
Ga0194129_105593001 | 3300020578 | Freshwater Lake | DLSELLDELREIEIYDTDPKDWMGYLKEDDYWDPVCELAY |
Ga0194126_101521855 | 3300020603 | Freshwater Lake | ELSELIDELREIAIYETDPQDWMGYLGDDNYYVPDRELAH |
Ga0194126_108547832 | 3300020603 | Freshwater Lake | MNPVELSELIDELREIAIYETDPQDWMGYLGDDNYYVPDRELAY |
Ga0194133_101106495 | 3300021091 | Freshwater Lake | MNSVELSELIDEVREIEIYNTDPADWMGYLEDDNSYVPDYELVY |
Ga0213867_100137423 | 3300021335 | Seawater | MDLSELIDELREIKIYETDPKDWMGVLEDDDYWEVATELVY |
Ga0213867_10566901 | 3300021335 | Seawater | QLEGYSMDLSELIDEIREIKIYETDPKDWMGVLEEDDYWEVATELVY |
Ga0213858_100596153 | 3300021356 | Seawater | MDLSELLDELREIKIYETDPKDWMGVLEDDDYWETVPELVY |
Ga0213858_100898774 | 3300021356 | Seawater | MDLSELIDELREIKIYETDPQDWMGVLEEDDYWDPVPELAY |
Ga0213860_100871372 | 3300021368 | Seawater | MDLSELIDELREIRIYETDPKDWMGVLEEDDYWEVATELVY |
Ga0213865_100269981 | 3300021373 | Seawater | MDLSELIDEIREIKIYETDPKDWMGVLEEDDYWEVATE |
Ga0213865_102064371 | 3300021373 | Seawater | SELIDELREIRIYETDPKDWMGVLEEDDYWEVATELVY |
Ga0194130_1000763127 | 3300021376 | Freshwater Lake | MDLSELLDELREIEIYDTDPKDWMGYLKEDDYWDPVCELAY |
Ga0194130_104722982 | 3300021376 | Freshwater Lake | SELIDELREIAIYETDPQDWMGYLELDDYWVPDRELAH |
Ga0194130_106264471 | 3300021376 | Freshwater Lake | MNSIELSELIDELREIAIYETDPQDWMGYLESDDYWVPHRELAH |
Ga0194117_102518192 | 3300021424 | Freshwater Lake | LSELIDELREIAIYETDPQDWMGYLESDNYWVPDRELAH |
Ga0213866_100343795 | 3300021425 | Seawater | MFSVELSEFIDEIREIEIYGSEPADWMGYLGSDDWWVPDQELAY |
Ga0213866_100509195 | 3300021425 | Seawater | MDLSELIDEIREIKIYETDPQDWMGVLEEDDYWEVATELVY |
Ga0213866_100789394 | 3300021425 | Seawater | MDLSELIDEIREIKIYETDPQDWMGVLEEDDYWDPITELAY |
Ga0213866_103320871 | 3300021425 | Seawater | MNLTELIEEIREIEIYGSEPSDWMGYMGSDDYWVPDEELAY |
Ga0222716_100736648 | 3300021959 | Estuarine Water | MDLSEILDEIREIEIYDVDPKDWMGYLKEDDFWDPVPELAY |
Ga0222716_105948143 | 3300021959 | Estuarine Water | YSMDLSELIDEIREIKIYETDPQDWMGVLEEDDYWETVPELVY |
Ga0222715_100232447 | 3300021960 | Estuarine Water | MDLSELIDEIREIKIYETDPQDWMGVLEEDDYWDPVPELVY |
Ga0222715_100241569 | 3300021960 | Estuarine Water | IKQLEGYSMDLSELIDEIREIKIYETDPKDWMGVLEEDDYWEVATELVY |
Ga0222715_100425615 | 3300021960 | Estuarine Water | MDLSELIEELREIKIYETDPQDWMGVLEKDDYWDPVPELVY |
Ga0222715_101913522 | 3300021960 | Estuarine Water | MDLSELIEEFRESEIYNTDPQDWMGYLKEDDYWVPDTELVY |
Ga0222715_102065602 | 3300021960 | Estuarine Water | MDLSELLDELREIKIYETDPKDWMGVLEEDDYWDPVTELAY |
Ga0222715_102353833 | 3300021960 | Estuarine Water | MDLSELIDELREMKIYETDPQDWMGVLEEDDYWDPVPELAY |
Ga0222715_104665122 | 3300021960 | Estuarine Water | MDLSELIEEFREIEIYGSNSQDWMGYLNEDDHWVPDHELVY |
Ga0222715_106135471 | 3300021960 | Estuarine Water | MDLSDLIDEIREIKIYETDPQDWMGVLEEDDYWDPVTELAY |
Ga0222714_1000025824 | 3300021961 | Estuarine Water | MDLSEMLDELREIEIYGSEPSDWMGYMGSDDYWVPDEELAY |
Ga0222714_1000535925 | 3300021961 | Estuarine Water | MDLSELIDELREIALYDSDPKDWMGYLESDDYWVPDSELAY |
Ga0222714_1001097421 | 3300021961 | Estuarine Water | MDLSEMLDELREIAIYETDPQDWMGYMENDDYWVPDVELAY |
Ga0222714_100117126 | 3300021961 | Estuarine Water | MDLSELLDELREIEIYDTDPKDWMGYLKEDDSWDPVPELAY |
Ga0222714_100211627 | 3300021961 | Estuarine Water | MDLSEVIDEIREIKIYETDPQDWMGVLEEDDYWETVPELVY |
Ga0222714_100661334 | 3300021961 | Estuarine Water | MDLSEILDEIREIEIYGNDPADWMGYLKEDDSWDPVPELAY |
Ga0222714_101132434 | 3300021961 | Estuarine Water | MDLSEMLDEIREIEIYDTDPKDWMGYLKEDDYWVPDVELAY |
Ga0222714_101736714 | 3300021961 | Estuarine Water | GYSMDLSELIDEIREIKIYETDPQDWMGVLEEDDYWETVPELVY |
Ga0222714_101872263 | 3300021961 | Estuarine Water | MDLSELIDEIREIKIYETDPQDWMGVLEEDDYWDPVTELAY |
Ga0222714_104702953 | 3300021961 | Estuarine Water | HLRFLMDLSELIDELREIKIYETDPQDWMNVLEEDDYWDPVVELAY |
Ga0222714_105078541 | 3300021961 | Estuarine Water | MDLSELIDELREIKIYETDPQDWMGVLEEDDYWDP |
Ga0222713_1000120222 | 3300021962 | Estuarine Water | MDLSELIDELREIEIYGSEPSDWMGYMSSDDYWVPDEELAY |
Ga0222713_102037012 | 3300021962 | Estuarine Water | MEHWRFSPPYATIIKQLEGYSMDLSELIDEIREIKIYETDPQDWMGVLEEDDYWDPVPELVY |
Ga0222713_106640621 | 3300021962 | Estuarine Water | MDLSEILDEIREIEIYDVDPKDWMGYLKEDDFWDPVPELVY |
Ga0222712_101949644 | 3300021963 | Estuarine Water | MDLSELIDEVREIALYETDPQDWMGYLEDDRIWVPDPELAY |
Ga0222712_103297862 | 3300021963 | Estuarine Water | MDLSELIEELREIEIYGSEPADWMGYLCDDEPWVPDSELAY |
Ga0222712_105983422 | 3300021963 | Estuarine Water | QLEGLLMDLSELIDEIREIKIYETDPQDWMGVLEEDDYWDPVTELAY |
Ga0196883_10160322 | 3300022050 | Aqueous | MDLSELIDEIREIKIYETDPKDWMGVLEEDDYYWEVATELVY |
Ga0212031_10309873 | 3300022176 | Aqueous | MNLTELIEEIREIDIYGSDPVDWMGYLANDDYWVPDEELAY |
Ga0181353_10798892 | 3300022179 | Freshwater Lake | MDLSELIDEIREIEIYGSEPADWMGYLGDDEPWVPDSELAY |
Ga0196899_10328852 | 3300022187 | Aqueous | MNLSEFIEEFREHEIYETDPQDWRGYLADDDYWVPDPELVY |
Ga0196905_10127705 | 3300022198 | Aqueous | MDLSELIDEIREIKIYETDPKDWMGVLEEDDYWETVPELVY |
Ga0196905_10184892 | 3300022198 | Aqueous | MDLSEMIDEIREIKIYETDPQDWMGVLEEDDYWDPVPELAY |
Ga0196905_10363911 | 3300022198 | Aqueous | SELIDELREIKIYETDPQDWMGVLEEDDYWDPVPELVY |
Ga0196905_11712352 | 3300022198 | Aqueous | MDLSELIDELREIKMYETDPQDWMGVLEDDDYWDPVPELAY |
Ga0196905_11815152 | 3300022198 | Aqueous | MDLSELIDELREIRIYETDPQDWMGVLEEDDYWDPVPELAY |
Ga0196901_10299853 | 3300022200 | Aqueous | MDLSEMIDEIREIKIYETDPQDWMGVLEEDDYWDPVTELAY |
Ga0196901_10438034 | 3300022200 | Aqueous | NLTELIEEIREIDIYGSDPVDWMGYLANDDYWVPDEELAY |
Ga0196901_10866592 | 3300022200 | Aqueous | MDLSELLDELREIKIYETDPKDWMGVLEEDDYWEVATELVY |
Ga0196901_11029912 | 3300022200 | Aqueous | MEHWRFSPPYATIIKQLEGYSMDLSELIDEIREIKIYETDPKDWMGVLEEDDYWEVATELVY |
Ga0214917_1000610412 | 3300022752 | Freshwater | MDLSELIDELREIAIYESDPQDWMGYMETDDFLVPDSELAY |
Ga0214917_104619761 | 3300022752 | Freshwater | MDLSELIDELREIAMYESDPQDWMGYLEDDDSWVPDSELAY |
Ga0255781_103978562 | 3300022934 | Salt Marsh | MDLSELLEDFRESEIYNSDPQDWMGYLKEDDYWVPDPELV |
Ga0255780_100668181 | 3300022935 | Salt Marsh | SFMDLSELIDELREIKIYETDPKDWMGVLEEDDYWDPVTELAY |
Ga0255780_103408012 | 3300022935 | Salt Marsh | MDLSEMLEELREIRIYETDPKDWMGVLEEDDYWEVATELVY |
Ga0255780_103471592 | 3300022935 | Salt Marsh | QVIEGYSMDLSELIDEIREIKIYETDPKDWMGVLEEDDYWETVPELVY |
Ga0255764_104466391 | 3300023081 | Salt Marsh | IDELREIKIYETDPKDWMGVLEEDDYWEVETELVY |
Ga0255778_101944301 | 3300023084 | Salt Marsh | ELIDELREIKIYETDPKDWMGVLEEDDYWEVETELVY |
Ga0255751_101569724 | 3300023116 | Salt Marsh | MDLSELIEEFRESELYETDPQDWMGYLKEDDYWLPDPEFVY |
Ga0255761_105001233 | 3300023170 | Salt Marsh | FRPHYATIIKQLEGYSMDLSELIDEIREIKIYETDPKDWMGVLEEDDYWEVATELVY |
Ga0255772_102382842 | 3300023176 | Salt Marsh | MDLSELLDELREIKIYETDPKDWMGVLEEDDYWEVETELVY |
Ga0255768_100773351 | 3300023180 | Salt Marsh | YATIIKQLEGYSMDLSELIDEIREIKIYETDPKDWMGVLEDDDYWEVATELVY |
Ga0255768_100867767 | 3300023180 | Salt Marsh | MDLSELIDEIREIKIYETDPKDWMGVLEEDDYWEVATEIVY |
Ga0244776_103375832 | 3300024348 | Estuarine | MDLSELIDEIREIKIYETDPQDWMGVLEQDDYWDPVTELAY |
Ga0255223_10125653 | 3300024480 | Freshwater | MDLSELIDELREIEIYGSEPSDWMGYMSSDDYWVPDEELVY |
Ga0208546_10029394 | 3300025585 | Aqueous | MDLSELIEELREIEIYGSEPSDWMGYLGSDDYWVPDEELAY |
Ga0208149_10549264 | 3300025610 | Aqueous | MDLSELIDEIREIKIYETDPKDWMGVLEEDDYWEVATELVY |
Ga0208004_10536341 | 3300025630 | Aqueous | ATIIKQLEGYSMDLSELIDEIREIKIYETDPKDWMGVLEEDDYYWEVATELVY |
Ga0208161_10511982 | 3300025646 | Aqueous | MNLTELIEEIREIDIYGSDPVDWMGYLANDDYWVPDEELVY |
Ga0208428_10375294 | 3300025653 | Aqueous | MDLSELIDEIREIKIYETDPQDWMGVLEEDDYWDPVPELAY |
Ga0208795_10864752 | 3300025655 | Aqueous | MNLTELIEEIREIEIYGSEPADWMGYLANDDYWVPDEELVY |
Ga0208795_11545362 | 3300025655 | Aqueous | MNLTELIEEIREIDIYGSDPVDWMGYLGSDDYWVPDEELAY |
Ga0208898_11522522 | 3300025671 | Aqueous | IDEIREIKIYETDPQDWMGVLEEDDYWETVPELVY |
Ga0208162_100047149 | 3300025674 | Aqueous | MNLTEFIEEIREIEIYGSDPVDWMGYLANDDYWVPDEELVY |
Ga0208162_100106228 | 3300025674 | Aqueous | MDLSELLDELREIKIYETDPKDWMGVLEEDDYWETVPELVY |
Ga0208162_10077966 | 3300025674 | Aqueous | MDLSELIEELREIEIYDTDPQDWMGYLKEDDYWEVATELVY |
Ga0208162_10789422 | 3300025674 | Aqueous | MDLSELIDELREIKIYETDPKDWMGVLEEDDYWLPDPELVY |
Ga0208162_10834844 | 3300025674 | Aqueous | MDLSELIDELREIKIYETDPKDWMGVLEDDDYWDPVTELAY |
Ga0208019_10596894 | 3300025687 | Aqueous | MDLSELIDELREIKIYETDPKDWMGVLEEDDYWDPVVELAY |
Ga0208427_10869241 | 3300025771 | Aqueous | ITKQLEGYSMDLSELIDEIREIKIYETDPKDWMGVLEEDDYWEVATELVY |
Ga0208917_11097411 | 3300025840 | Aqueous | PHYATIIKQLEGYSMDLSELIDEIREIKIYETDPKDWMGVLEEDDYWEVATELVY |
Ga0208644_11617194 | 3300025889 | Aqueous | SPPYATIIKQLEGYSMDLSELIDEIREIKIYETDPKDWMGVLEEDDYWDPVPELAY |
Ga0208880_10140774 | 3300026085 | Marine | MDLSELIEEFRESEIYETDPQDWMGYLKSDDYWVPDPELVY |
Ga0209856_10027962 | 3300026837 | Sand | MDLSELIDEVREIALYETDPQDWMGYLEDDRIWVPDPELVY |
Ga0255100_10934781 | 3300027152 | Freshwater | MDLSELIDELREIALYESDPQDWMGYLENDDYWVPDPELAYXRSERRLGAL |
Ga0209867_10227581 | 3300027393 | Sand | LSELIEELREIEIYGSEPADWMGYLENDDYWVPDHELAY |
Ga0255088_10897811 | 3300027597 | Freshwater | MDLSELIEELREIEIYGSEPADWMGYLENDDYWVPD |
Ga0209704_11549021 | 3300027693 | Freshwater Sediment | MNSVELSELIDEIREIEIYRSNPQDWMNYLDSDDHYEPDHELVYXSLQTLQDALQ |
Ga0209492_10068336 | 3300027721 | Freshwater Sediment | MNSVELSELIDEIREIEIYRSNPQDWMNYLDSDDHYEPDHELAY |
Ga0209287_103416952 | 3300027792 | Freshwater Sediment | MNSTELSELIDEIREIEIYGQDPQDWMNYLESDDYYVPDHELAY |
Ga0209990_100541345 | 3300027816 | Freshwater Lake | MDLSELIDELREIKMYETDPQDWMGYLEEDDYWDPVRELAY |
Ga0209536_1005727661 | 3300027917 | Marine Sediment | PIELSELIEEFREITLYDTNPQDWMGYLESDDWWVPDQELAY |
Ga0209536_1008302383 | 3300027917 | Marine Sediment | PIELSELIEEFREITLYDTNPQDWMGYLESDDYWEVNKELVY |
Ga0209536_1009886873 | 3300027917 | Marine Sediment | MDLSELIDEIREIKIYETDPQDWMGVLEEDDYWETVPELVYXLARGV |
Ga0209893_10048731 | 3300027940 | Sand | MDLSELIDELREIALYESDPQDWMGYLENDDYWVPDPE |
Ga0255233_11036921 | 3300029699 | Freshwater | TMDLSELIDELREIEIYGSEPSDWMGYMSSDDYWVPDEELVY |
Ga0119944_10009432 | 3300029930 | Aquatic | MDLSELIDELREINLYDSDPQDWMGYLENDDYWVPDPELAY |
Ga0119944_10032484 | 3300029930 | Aquatic | MDLSELIEELREIEIYGSEPSDWMGYLENDDYWVPDPELAY |
Ga0119944_10047691 | 3300029930 | Aquatic | MDLSELIDELREIAMYETDPQDWMGYLENDDYWVPDSEL |
Ga0119944_10056994 | 3300029930 | Aquatic | MDLSELIDELREIAIYETDPQDWMGYLEDDSTWVPDVELAY |
Ga0119944_10074003 | 3300029930 | Aquatic | MDLSELIDEVREINLYETDPQDWMGYLENDDYWVPDSELAY |
Ga0119944_10091392 | 3300029930 | Aquatic | MNLTELIEELREIEIYGSDPIDWMGYMESDDYWVPDYELAY |
Ga0119944_10134961 | 3300029930 | Aquatic | MDLSELIDELREIAMYETDPQDWMGYLENDDYWVPDS |
Ga0119944_10421781 | 3300029930 | Aquatic | MDLSELIDELREIAMYETDPQDWMGYLEDDSPWVPDSELAY |
Ga0119933_10004862 | 3300029932 | Drinking Water Treatment Plant | MDLSELIDELREIAMYETDPQDWMGYLENDDYWVPDHELAY |
Ga0307376_107608472 | 3300031578 | Soil | MDLSELIDELREIRIYETDPKDWMGVLEDDDYWEVATELVY |
Ga0307376_107878692 | 3300031578 | Soil | MDLSELIDELREIKIYETDPKDWMGVLEEDDYWDPVPELAY |
Ga0315907_101314968 | 3300031758 | Freshwater | MNLTELIEEIREIEIYGSDPADWMGYLGSDDYWVPDEELAY |
Ga0315907_107771631 | 3300031758 | Freshwater | MDLSELIEELREIEIYGSEPADWMGYLYDDDFWVP |
Ga0315899_1002923410 | 3300031784 | Freshwater | MDLSELIEELREIEIYGSEPADWMGYLYDDDFWVPDHELAY |
Ga0315909_102307992 | 3300031857 | Freshwater | MDLSELIEELREIEIYGSEPADWMGFLGDDEPWVPDPELAY |
Ga0315909_108089852 | 3300031857 | Freshwater | MNLTELIEEIREIEIYGSDPVDWMGYLSSDDYWVPDEELAH |
Ga0315909_108243702 | 3300031857 | Freshwater | MNLTELIEEIREIEIYGSDPVDWMGYLDNDDYWVPDIELAY |
Ga0315904_100990993 | 3300031951 | Freshwater | MDLSELIDEIREIVIYETNPEDWMGYVEYDDLDVPDVELAH |
Ga0315904_104233494 | 3300031951 | Freshwater | MDLSELIEELREIAIYETDPQDWMGYLEDDSTWVPDQELAY |
Ga0315904_107290871 | 3300031951 | Freshwater | MDLSELIEELREIEIYGSEPADWMGYLCDDEPWVPDPELAY |
Ga0315906_100643681 | 3300032050 | Freshwater | DLSELLDEIREIEIYGNDPADWMGYLKEDDSWDPVPELAY |
Ga0315906_107988891 | 3300032050 | Freshwater | MDLSELIDELREIKMYETDPQDWMGYLEEDDYWDPVRE |
Ga0316616_10000000921 | 3300033521 | Soil | MNLSEFLDELREIQIYGTDPADWMGYLESDDHWVPEVELSH |
Ga0334977_0000608_11240_11365 | 3300033978 | Freshwater | MDLSELIDELREIAMYESDPQDWMGYLENDDYWVPDSELAY |
Ga0334978_0167150_579_704 | 3300033979 | Freshwater | MDLSELMDELREIAMYESDPQDWMGYLEDDDSWVPDSELAY |
Ga0334996_0009290_2857_2982 | 3300033994 | Freshwater | MDLSELIEELREIEIYGSDPVDWMGYLYDDDYWVPDTELAQ |
Ga0334986_0005204_5159_5284 | 3300034012 | Freshwater | MDLSELIDELREIAMYESDPQDWMGYLENDDSWVPDSELAY |
Ga0334986_0195068_342_467 | 3300034012 | Freshwater | MDLSELIEEFREITLYDSDPQDWMGILESDDYWVPDQELAY |
Ga0310127_265603_7_132 | 3300034072 | Fracking Water | MDLSELIDELREIAMYESDPQDWMGYLESDDSWVPDSELAY |
Ga0310130_0003820_119_244 | 3300034073 | Fracking Water | MDLSELIDEIREIAIYGTNPEDWMGYVEYDDLDVPDVELAY |
Ga0310130_0009465_2432_2557 | 3300034073 | Fracking Water | MDLSELIDEIREIAIYETNPEDWMGYVEYDDLDVPDVELAH |
Ga0310130_0013035_2169_2294 | 3300034073 | Fracking Water | MDLSELIDELREIAMYESDPQDWMGYLESDDSWVPDSELVY |
Ga0310130_0054455_873_998 | 3300034073 | Fracking Water | MNLTELIEEIREIEIYGSDPIDWMGYLANDDYWVPDEELAY |
Ga0310130_0229915_260_385 | 3300034073 | Fracking Water | MDLSELIDELREIAMYESDPQDWMGYLDDDEPWVPDSELAY |
Ga0310130_0277084_56_190 | 3300034073 | Fracking Water | MNSIEISELIDEIREIEIYQCDPQDWMGYLDSDDYVVPDHELAY |
Ga0335029_0000154_45655_45780 | 3300034102 | Freshwater | MDLSELIEELREIEIYGSEPADWMGFLGDDDSWVPDHELAY |
Ga0335029_0107150_804_929 | 3300034102 | Freshwater | MDLSELIEEFREIALYDSDPQDWMGILESDDYWVPDQELAY |
Ga0335029_0181193_60_185 | 3300034102 | Freshwater | MDLSEFLDELREIAIYNTNPQDWMGILESDDYRVPDPELAH |
Ga0348337_135217_24_149 | 3300034418 | Aqueous | MDLSELIDEIREIKIYETDPKDWMGVLEEDDYWDPVPELAY |
⦗Top⦘ |