Basic Information | |
---|---|
Family ID | F009040 |
Family Type | Metagenome / Metatranscriptome |
Number of Sequences | 324 |
Average Sequence Length | 44 residues |
Representative Sequence | PPQAAAVKSRGGERCGNAGTMIPAGTVERGERKRTADEVSKAD |
Number of Associated Samples | 277 |
Number of Associated Scaffolds | 324 |
Quality Assessment | |
---|---|
Transcriptomic Evidence | Yes |
Most common taxonomic group | Bacteria |
% of genes with valid RBS motifs | 1.54 % |
% of genes near scaffold ends (potentially truncated) | 94.75 % |
% of genes from short scaffolds (< 2000 bps) | 91.98 % |
Associated GOLD sequencing projects | 261 |
AlphaFold2 3D model prediction | Yes |
3D model pTM-score | 0.14 |
Hidden Markov Model |
---|
Powered by Skylign |
Most Common Taxonomy | |
---|---|
Group | Bacteria (73.765 % of family members) |
NCBI Taxonomy ID | 2 |
Taxonomy | All Organisms → cellular organisms → Bacteria |
Most Common Ecosystem | |
---|---|
GOLD Ecosystem | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil (11.420 % of family members) |
Environment Ontology (ENVO) | Unclassified (24.691 % of family members) |
Earth Microbiome Project Ontology (EMPO) | Free-living → Non-saline → Soil (non-saline) (45.988 % of family members) |
⦗Top⦘ |
⦗Top⦘ |
Predicted Topology & Secondary Structure | |||||
---|---|---|---|---|---|
Classification: | Fibrous | Signal Peptide: | No | Secondary Structure distribution: | α-helix: 0.00% β-sheet: 0.00% Coil/Unstructured: 100.00% | Feature Viewer |
|
|||||
Powered by Feature Viewer |
Structure Viewer | |
---|---|
| |
Per-residue confidence (pLDDT): 0-50 51-70 71-90 91-100 | pTM-score: 0.14 |
Powered by PDBe Molstar |
⦗Top⦘ |
Pfam ID | Name | % Frequency in 324 Family Scaffolds |
---|---|---|
PF00078 | RVT_1 | 8.33 |
PF08388 | GIIM | 7.72 |
PF02371 | Transposase_20 | 6.48 |
PF01548 | DEDD_Tnp_IS110 | 2.47 |
PF13458 | Peripla_BP_6 | 0.62 |
PF00589 | Phage_integrase | 0.62 |
PF13683 | rve_3 | 0.62 |
PF00881 | Nitroreductase | 0.62 |
PF13408 | Zn_ribbon_recom | 0.31 |
PF13356 | Arm-DNA-bind_3 | 0.31 |
PF00106 | adh_short | 0.31 |
PF02211 | NHase_beta | 0.31 |
PF00364 | Biotin_lipoyl | 0.31 |
PF04392 | ABC_sub_bind | 0.31 |
PF13432 | TPR_16 | 0.31 |
PF00583 | Acetyltransf_1 | 0.31 |
PF12680 | SnoaL_2 | 0.31 |
PF05598 | DUF772 | 0.31 |
PF00903 | Glyoxalase | 0.31 |
PF13586 | DDE_Tnp_1_2 | 0.31 |
PF08483 | Obsolete Pfam Family | 0.31 |
PF14319 | Zn_Tnp_IS91 | 0.31 |
PF13701 | DDE_Tnp_1_4 | 0.31 |
PF01609 | DDE_Tnp_1 | 0.31 |
PF04986 | Y2_Tnp | 0.31 |
PF13333 | rve_2 | 0.31 |
PF13414 | TPR_11 | 0.31 |
PF13546 | DDE_5 | 0.31 |
PF05930 | Phage_AlpA | 0.31 |
PF13384 | HTH_23 | 0.31 |
PF13531 | SBP_bac_11 | 0.31 |
PF00132 | Hexapep | 0.31 |
PF01380 | SIS | 0.31 |
PF12833 | HTH_18 | 0.31 |
PF08282 | Hydrolase_3 | 0.31 |
COG ID | Name | Functional Category | % Frequency in 324 Family Scaffolds |
---|---|---|---|
COG3547 | Transposase | Mobilome: prophages, transposons [X] | 8.95 |
COG0560 | Phosphoserine phosphatase | Amino acid transport and metabolism [E] | 0.31 |
COG0561 | Hydroxymethylpyrimidine pyrophosphatase and other HAD family phosphatases | Coenzyme transport and metabolism [H] | 0.31 |
COG1877 | Trehalose-6-phosphate phosphatase | Carbohydrate transport and metabolism [G] | 0.31 |
COG2217 | Cation-transporting P-type ATPase | Inorganic ion transport and metabolism [P] | 0.31 |
COG2984 | ABC-type uncharacterized transport system, periplasmic component | General function prediction only [R] | 0.31 |
COG3039 | Transposase and inactivated derivatives, IS5 family | Mobilome: prophages, transposons [X] | 0.31 |
COG3293 | Transposase | Mobilome: prophages, transposons [X] | 0.31 |
COG3311 | DNA-binding transcriptional regulator AlpA | Transcription [K] | 0.31 |
COG3385 | IS4 transposase InsG | Mobilome: prophages, transposons [X] | 0.31 |
COG3769 | Mannosyl-3-phosphoglycerate phosphatase YedP/MpgP, HAD superfamily | Carbohydrate transport and metabolism [G] | 0.31 |
COG5421 | Transposase | Mobilome: prophages, transposons [X] | 0.31 |
COG5433 | Predicted transposase YbfD/YdcC associated with H repeats | Mobilome: prophages, transposons [X] | 0.31 |
COG5659 | SRSO17 transposase | Mobilome: prophages, transposons [X] | 0.31 |
⦗Top⦘ |
Name | Rank | Taxonomy | Distribution |
All Organisms | root | All Organisms | 75.93 % |
Unclassified | root | N/A | 24.07 % |
Visualization |
---|
Powered by ApexCharts |
Scaffold | Taxonomy | Length | IMG/M Link |
---|---|---|---|
2140918005|contig01774 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium mongolense → Rhizobium mongolense USDA 1844 | 662 | Open in IMG/M |
2170459024|GZRSKLJ01B4BDW | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 536 | Open in IMG/M |
3300000189|BBAY58_c10028685 | Not Available | 862 | Open in IMG/M |
3300000242|TDF_OR_ARG05_123mDRAFT_1074611 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 656 | Open in IMG/M |
3300000793|AF_2010_repII_A001DRAFT_10082512 | Not Available | 686 | Open in IMG/M |
3300001083|JGI12678J13193_1005890 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 523 | Open in IMG/M |
3300001162|JGI12714J13572_1008166 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium mongolense → Rhizobium mongolense USDA 1844 | 553 | Open in IMG/M |
3300001179|JGI12660J13575_100250 | Not Available | 1531 | Open in IMG/M |
3300001394|JGI20191J14862_1053578 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 516 | Open in IMG/M |
3300001404|JGI20181J14860_1011662 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 700 | Open in IMG/M |
3300001593|JGI12635J15846_10872404 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 514 | Open in IMG/M |
3300001618|JGI20264J16347_10161 | Not Available | 1063 | Open in IMG/M |
3300002921|BIH8_10012724 | Not Available | 1912 | Open in IMG/M |
3300003224|JGI26344J46810_1018771 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 578 | Open in IMG/M |
3300003861|Ga0031654_10215208 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 551 | Open in IMG/M |
3300003885|Ga0063294_10586594 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49 | 664 | Open in IMG/M |
3300004023|Ga0055441_10172871 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium mongolense → Rhizobium mongolense USDA 1844 | 591 | Open in IMG/M |
3300004099|Ga0058900_1425139 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 504 | Open in IMG/M |
3300004152|Ga0062386_101532747 | All Organisms → cellular organisms → Bacteria | 556 | Open in IMG/M |
3300004602|Ga0068960_1272378 | Not Available | 700 | Open in IMG/M |
3300004633|Ga0066395_10021291 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2582 | Open in IMG/M |
3300004633|Ga0066395_10037616 | All Organisms → cellular organisms → Bacteria | 2064 | Open in IMG/M |
3300005103|Ga0066813_1015657 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 514 | Open in IMG/M |
3300005158|Ga0066816_1019142 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 567 | Open in IMG/M |
3300005332|Ga0066388_104293482 | All Organisms → cellular organisms → Bacteria | 726 | Open in IMG/M |
3300005332|Ga0066388_105713078 | Not Available | 629 | Open in IMG/M |
3300005332|Ga0066388_106764244 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 577 | Open in IMG/M |
3300005344|Ga0070661_100234578 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1411 | Open in IMG/M |
3300005356|Ga0070674_101831863 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 551 | Open in IMG/M |
3300005363|Ga0008090_15704923 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1751 | Open in IMG/M |
3300005439|Ga0070711_100065831 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2536 | Open in IMG/M |
3300005439|Ga0070711_100714099 | All Organisms → cellular organisms → Bacteria | 845 | Open in IMG/M |
3300005590|Ga0070727_10752880 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49 | 546 | Open in IMG/M |
3300005612|Ga0070723_10568537 | All Organisms → cellular organisms → Bacteria | 566 | Open in IMG/M |
3300005614|Ga0068856_102360630 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 539 | Open in IMG/M |
3300005713|Ga0066905_100016249 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3792 | Open in IMG/M |
3300005719|Ga0068861_102649605 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 506 | Open in IMG/M |
3300005764|Ga0066903_100683272 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1804 | Open in IMG/M |
3300005764|Ga0066903_105460609 | Not Available | 670 | Open in IMG/M |
3300005953|Ga0066383_10033242 | Not Available | 1676 | Open in IMG/M |
3300005994|Ga0066789_10197926 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 847 | Open in IMG/M |
3300005995|Ga0066790_10384566 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 600 | Open in IMG/M |
3300005995|Ga0066790_10511083 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 513 | Open in IMG/M |
3300006047|Ga0075024_100062405 | Not Available | 1574 | Open in IMG/M |
3300006047|Ga0075024_100531546 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 621 | Open in IMG/M |
3300006102|Ga0075015_100401631 | Not Available | 773 | Open in IMG/M |
3300006162|Ga0075030_100187927 | Not Available | 1666 | Open in IMG/M |
3300006163|Ga0070715_10721151 | Not Available | 598 | Open in IMG/M |
3300006174|Ga0075014_100904654 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 528 | Open in IMG/M |
3300006176|Ga0070765_101670146 | All Organisms → cellular organisms → Bacteria | 598 | Open in IMG/M |
3300006235|Ga0082395_1031965 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 545 | Open in IMG/M |
3300006354|Ga0075021_10889682 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 578 | Open in IMG/M |
3300006465|Ga0082250_10001800 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 3857 | Open in IMG/M |
3300006606|Ga0074062_13001399 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 747 | Open in IMG/M |
3300006755|Ga0079222_10010900 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3298 | Open in IMG/M |
3300006792|Ga0075530_1067987 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1210 | Open in IMG/M |
3300006844|Ga0075428_101432769 | Not Available | 725 | Open in IMG/M |
3300006854|Ga0075425_102846165 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 532 | Open in IMG/M |
3300006864|Ga0066797_1278970 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 583 | Open in IMG/M |
3300006953|Ga0074063_14275835 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 904 | Open in IMG/M |
3300007255|Ga0099791_10117849 | All Organisms → cellular organisms → Bacteria | 1229 | Open in IMG/M |
3300007255|Ga0099791_10507693 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 586 | Open in IMG/M |
3300007788|Ga0099795_10097791 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1147 | Open in IMG/M |
3300008470|Ga0115371_10046380 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 646 | Open in IMG/M |
3300008470|Ga0115371_10176852 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 684 | Open in IMG/M |
3300009036|Ga0105244_10270213 | Not Available | 790 | Open in IMG/M |
3300009038|Ga0099829_10642395 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 882 | Open in IMG/M |
3300009089|Ga0099828_11547862 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 584 | Open in IMG/M |
3300009147|Ga0114129_10494264 | All Organisms → cellular organisms → Bacteria | 1599 | Open in IMG/M |
3300009156|Ga0111538_10364593 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1829 | Open in IMG/M |
3300009174|Ga0105241_11882205 | Not Available | 586 | Open in IMG/M |
3300009177|Ga0105248_10152313 | All Organisms → cellular organisms → Bacteria | 2609 | Open in IMG/M |
3300009177|Ga0105248_10262356 | Not Available | 1945 | Open in IMG/M |
3300009488|Ga0114925_10339226 | Not Available | 1027 | Open in IMG/M |
3300009488|Ga0114925_10998259 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 609 | Open in IMG/M |
3300009519|Ga0116108_1198117 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 590 | Open in IMG/M |
3300009525|Ga0116220_10245761 | Not Available | 781 | Open in IMG/M |
3300009545|Ga0105237_11399744 | Not Available | 706 | Open in IMG/M |
3300009553|Ga0105249_12705313 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 568 | Open in IMG/M |
3300009641|Ga0116120_1091741 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1008 | Open in IMG/M |
3300009641|Ga0116120_1170318 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 697 | Open in IMG/M |
3300009643|Ga0116110_1128994 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 844 | Open in IMG/M |
3300009645|Ga0116106_1197405 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 641 | Open in IMG/M |
3300009646|Ga0116132_1069245 | Not Available | 1107 | Open in IMG/M |
3300009661|Ga0105858_1096912 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 790 | Open in IMG/M |
3300009672|Ga0116215_1058681 | Not Available | 1741 | Open in IMG/M |
3300009683|Ga0116224_10427231 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 630 | Open in IMG/M |
3300009817|Ga0105062_1124886 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 524 | Open in IMG/M |
3300010043|Ga0126380_10074822 | All Organisms → cellular organisms → Bacteria | 1937 | Open in IMG/M |
3300010043|Ga0126380_10157394 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1465 | Open in IMG/M |
3300010043|Ga0126380_12058637 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 524 | Open in IMG/M |
3300010047|Ga0126382_12113123 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 539 | Open in IMG/M |
3300010047|Ga0126382_12148786 | All Organisms → cellular organisms → Bacteria | 536 | Open in IMG/M |
3300010147|Ga0126319_1557693 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 552 | Open in IMG/M |
3300010358|Ga0126370_12372466 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 526 | Open in IMG/M |
3300010359|Ga0126376_10106768 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2149 | Open in IMG/M |
3300010359|Ga0126376_11291302 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 749 | Open in IMG/M |
3300010359|Ga0126376_11709560 | Not Available | 665 | Open in IMG/M |
3300010360|Ga0126372_10333154 | Not Available | 1352 | Open in IMG/M |
3300010360|Ga0126372_11213819 | All Organisms → cellular organisms → Bacteria | 779 | Open in IMG/M |
3300010360|Ga0126372_11261872 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 766 | Open in IMG/M |
3300010361|Ga0126378_12888048 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium mongolense → Rhizobium mongolense USDA 1844 | 548 | Open in IMG/M |
3300010362|Ga0126377_13042225 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 541 | Open in IMG/M |
3300010376|Ga0126381_101908518 | Not Available | 857 | Open in IMG/M |
3300010376|Ga0126381_104430671 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 543 | Open in IMG/M |
3300010376|Ga0126381_104612356 | Not Available | 531 | Open in IMG/M |
3300010379|Ga0136449_102571172 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 727 | Open in IMG/M |
3300010397|Ga0134124_10418759 | Not Available | 1278 | Open in IMG/M |
3300010398|Ga0126383_10109387 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2490 | Open in IMG/M |
3300010398|Ga0126383_13631956 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 504 | Open in IMG/M |
3300010866|Ga0126344_1271673 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49 | 504 | Open in IMG/M |
3300010868|Ga0124844_1230229 | All Organisms → cellular organisms → Bacteria | 663 | Open in IMG/M |
3300011120|Ga0150983_13811945 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 544 | Open in IMG/M |
3300011415|Ga0137325_1105931 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 640 | Open in IMG/M |
3300011439|Ga0137432_1218791 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 615 | Open in IMG/M |
3300012096|Ga0137389_10457647 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1093 | Open in IMG/M |
3300012177|Ga0153943_1032068 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 1143 | Open in IMG/M |
3300012200|Ga0137382_10540481 | Not Available | 830 | Open in IMG/M |
3300012201|Ga0137365_11071254 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49 | 582 | Open in IMG/M |
3300012210|Ga0137378_10350872 | All Organisms → cellular organisms → Bacteria | 1371 | Open in IMG/M |
3300012226|Ga0137447_1094597 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 590 | Open in IMG/M |
3300012362|Ga0137361_10070363 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2962 | Open in IMG/M |
3300012362|Ga0137361_11007119 | Not Available | 753 | Open in IMG/M |
3300012395|Ga0134044_1002847 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 644 | Open in IMG/M |
3300012677|Ga0153928_1065414 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 699 | Open in IMG/M |
3300012685|Ga0137397_10280779 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1241 | Open in IMG/M |
3300012917|Ga0137395_10504022 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 872 | Open in IMG/M |
3300012927|Ga0137416_10703728 | Not Available | 888 | Open in IMG/M |
3300012944|Ga0137410_10109919 | Not Available | 2056 | Open in IMG/M |
3300012971|Ga0126369_11310699 | All Organisms → cellular organisms → Bacteria | 814 | Open in IMG/M |
3300012984|Ga0164309_11788746 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 527 | Open in IMG/M |
3300013098|Ga0164320_10681643 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 542 | Open in IMG/M |
3300013306|Ga0163162_12014487 | Not Available | 662 | Open in IMG/M |
3300013763|Ga0120179_1126797 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 560 | Open in IMG/M |
3300014159|Ga0181530_10162152 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1263 | Open in IMG/M |
3300014272|Ga0075327_1025134 | Not Available | 1776 | Open in IMG/M |
3300014501|Ga0182024_12849839 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 513 | Open in IMG/M |
3300016294|Ga0182041_10494868 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1059 | Open in IMG/M |
3300016294|Ga0182041_12108719 | Not Available | 526 | Open in IMG/M |
3300016319|Ga0182033_10540262 | Not Available | 1006 | Open in IMG/M |
3300016341|Ga0182035_10758167 | Not Available | 849 | Open in IMG/M |
3300016371|Ga0182034_10212615 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1503 | Open in IMG/M |
3300016387|Ga0182040_10136174 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1729 | Open in IMG/M |
3300016387|Ga0182040_10380766 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium mongolense → Rhizobium mongolense USDA 1844 | 1102 | Open in IMG/M |
3300016387|Ga0182040_11985364 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 500 | Open in IMG/M |
3300016422|Ga0182039_10115872 | Not Available | 2010 | Open in IMG/M |
3300016422|Ga0182039_11964435 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 538 | Open in IMG/M |
3300017926|Ga0187807_1275225 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 555 | Open in IMG/M |
3300017959|Ga0187779_11090760 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales | 557 | Open in IMG/M |
3300018007|Ga0187805_10367894 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 665 | Open in IMG/M |
3300018008|Ga0187888_1241434 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 705 | Open in IMG/M |
3300018019|Ga0187874_10452211 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 517 | Open in IMG/M |
3300018020|Ga0187861_10342996 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → unclassified Beijerinckiaceae → Beijerinckiaceae bacterium | 633 | Open in IMG/M |
3300018022|Ga0187864_10098718 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1523 | Open in IMG/M |
3300018029|Ga0187787_10211970 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 689 | Open in IMG/M |
3300018032|Ga0187788_10046606 | All Organisms → cellular organisms → Bacteria | 1462 | Open in IMG/M |
3300018032|Ga0187788_10102599 | Not Available | 1035 | Open in IMG/M |
3300018033|Ga0187867_10055267 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 2375 | Open in IMG/M |
3300018034|Ga0187863_10698503 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 573 | Open in IMG/M |
3300018035|Ga0187875_10327414 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 826 | Open in IMG/M |
3300018058|Ga0187766_10119991 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1611 | Open in IMG/M |
3300018060|Ga0187765_10568177 | Not Available | 728 | Open in IMG/M |
3300018062|Ga0187784_10966101 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 677 | Open in IMG/M |
3300018466|Ga0190268_10530543 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae | 810 | Open in IMG/M |
3300018468|Ga0066662_12261127 | All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → Mucilaginibacter → unclassified Mucilaginibacter → Mucilaginibacter sp. Bleaf8 | 571 | Open in IMG/M |
3300019194|Ga0184586_127797 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 563 | Open in IMG/M |
3300019232|Ga0180114_1066631 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 527 | Open in IMG/M |
3300019248|Ga0180117_1115948 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 530 | Open in IMG/M |
3300019256|Ga0181508_1327222 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 676 | Open in IMG/M |
3300019789|Ga0137408_1396603 | All Organisms → cellular organisms → Bacteria | 1158 | Open in IMG/M |
3300020140|Ga0179590_1099315 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 783 | Open in IMG/M |
3300020231|Ga0212168_1215353 | Not Available | 2386 | Open in IMG/M |
3300020447|Ga0211691_10152542 | Not Available | 875 | Open in IMG/M |
3300020579|Ga0210407_10470829 | All Organisms → cellular organisms → Bacteria | 982 | Open in IMG/M |
3300021078|Ga0210381_10268063 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 610 | Open in IMG/M |
3300021086|Ga0179596_10691417 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium mongolense → Rhizobium mongolense USDA 1844 | 516 | Open in IMG/M |
3300021178|Ga0210408_10040088 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 3679 | Open in IMG/M |
3300021420|Ga0210394_10983473 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 731 | Open in IMG/M |
3300021420|Ga0210394_11507539 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 568 | Open in IMG/M |
3300021420|Ga0210394_11853853 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 501 | Open in IMG/M |
3300021432|Ga0210384_10089861 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2758 | Open in IMG/M |
3300021475|Ga0210392_10127150 | Not Available | 1713 | Open in IMG/M |
3300021476|Ga0187846_10310720 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 651 | Open in IMG/M |
3300021478|Ga0210402_10495745 | All Organisms → cellular organisms → Bacteria | 1134 | Open in IMG/M |
3300021560|Ga0126371_10707699 | Not Available | 1155 | Open in IMG/M |
3300021860|Ga0213851_1125500 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 1386 | Open in IMG/M |
3300022413|Ga0224508_10694044 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 624 | Open in IMG/M |
3300022532|Ga0242655_10260783 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 552 | Open in IMG/M |
3300024058|Ga0209997_10218755 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 931 | Open in IMG/M |
3300024060|Ga0209987_10159483 | Not Available | 1294 | Open in IMG/M |
3300024060|Ga0209987_10496237 | All Organisms → cellular organisms → Bacteria | 654 | Open in IMG/M |
3300024227|Ga0228598_1117888 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium mongolense → Rhizobium mongolense USDA 1844 | 538 | Open in IMG/M |
3300024265|Ga0209976_10069783 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1841 | Open in IMG/M |
(restricted) 3300024302|Ga0233449_1003919 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Litoreibacter → Litoreibacter halocynthiae | 10497 | Open in IMG/M |
3300024429|Ga0209991_10400122 | Not Available | 642 | Open in IMG/M |
3300024432|Ga0209977_10051809 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1997 | Open in IMG/M |
3300024432|Ga0209977_10348273 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49 | 707 | Open in IMG/M |
3300024432|Ga0209977_10386961 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49 | 664 | Open in IMG/M |
3300024432|Ga0209977_10531656 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 544 | Open in IMG/M |
3300025453|Ga0208455_1016674 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1794 | Open in IMG/M |
3300025501|Ga0208563_1111685 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 520 | Open in IMG/M |
3300025507|Ga0208188_1076839 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 784 | Open in IMG/M |
3300025582|Ga0209386_1064395 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 651 | Open in IMG/M |
3300025582|Ga0209386_1098150 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49 | 521 | Open in IMG/M |
3300025693|Ga0209826_1247589 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 503 | Open in IMG/M |
3300025725|Ga0209638_1153223 | Not Available | 740 | Open in IMG/M |
3300025809|Ga0209199_1001339 | All Organisms → cellular organisms → Bacteria | 29945 | Open in IMG/M |
3300025891|Ga0209585_10513940 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 500 | Open in IMG/M |
3300025898|Ga0207692_10835912 | All Organisms → cellular organisms → Bacteria | 603 | Open in IMG/M |
3300025903|Ga0207680_11376111 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 501 | Open in IMG/M |
3300025906|Ga0207699_11304697 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 537 | Open in IMG/M |
3300025930|Ga0207701_11500899 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49 | 546 | Open in IMG/M |
3300026023|Ga0207677_11594829 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 604 | Open in IMG/M |
3300026046|Ga0208780_1020400 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 608 | Open in IMG/M |
3300026088|Ga0207641_11514640 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 672 | Open in IMG/M |
3300026121|Ga0207683_10365338 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 1325 | Open in IMG/M |
3300026221|Ga0209848_1004890 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 2763 | Open in IMG/M |
3300026294|Ga0209839_10037355 | Not Available | 1811 | Open in IMG/M |
3300026296|Ga0209235_1178296 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 785 | Open in IMG/M |
3300026354|Ga0257180_1012524 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1034 | Open in IMG/M |
3300026355|Ga0257149_1012496 | Not Available | 1113 | Open in IMG/M |
3300026481|Ga0257155_1029808 | Not Available | 810 | Open in IMG/M |
3300026494|Ga0257159_1063090 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 634 | Open in IMG/M |
3300026496|Ga0257157_1006495 | Not Available | 1806 | Open in IMG/M |
3300026496|Ga0257157_1087950 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 539 | Open in IMG/M |
3300026746|Ga0207454_102791 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 602 | Open in IMG/M |
3300026810|Ga0207801_101307 | Not Available | 1842 | Open in IMG/M |
3300026857|Ga0208893_1003162 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 593 | Open in IMG/M |
3300026865|Ga0207746_1016950 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 614 | Open in IMG/M |
3300026909|Ga0207858_1016983 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 704 | Open in IMG/M |
3300027013|Ga0209884_1029615 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 574 | Open in IMG/M |
3300027014|Ga0207815_1033778 | Not Available | 621 | Open in IMG/M |
3300027307|Ga0209327_1032942 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 725 | Open in IMG/M |
3300027461|Ga0207601_109537 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 621 | Open in IMG/M |
3300027497|Ga0208199_1032802 | All Organisms → cellular organisms → Bacteria | 1134 | Open in IMG/M |
3300027502|Ga0209622_1007268 | All Organisms → cellular organisms → Bacteria | 1815 | Open in IMG/M |
3300027527|Ga0209684_1037036 | Not Available | 747 | Open in IMG/M |
3300027537|Ga0209419_1015213 | Not Available | 1360 | Open in IMG/M |
3300027570|Ga0208043_1062111 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1067 | Open in IMG/M |
3300027583|Ga0209527_1012966 | Not Available | 1791 | Open in IMG/M |
3300027643|Ga0209076_1185157 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 575 | Open in IMG/M |
3300027645|Ga0209117_1065037 | All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Fungi incertae sedis → Mucoromycota → Glomeromycotina → Glomeromycetes → Glomerales → Glomeraceae → Glomus → Glomus cerebriforme | 1049 | Open in IMG/M |
3300027655|Ga0209388_1232655 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 504 | Open in IMG/M |
3300027678|Ga0209011_1045994 | Not Available | 1345 | Open in IMG/M |
3300027698|Ga0209446_1011044 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2216 | Open in IMG/M |
3300027725|Ga0209178_1128641 | Not Available | 863 | Open in IMG/M |
3300027742|Ga0209121_10063355 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium mongolense → Rhizobium mongolense USDA 1844 | 1787 | Open in IMG/M |
3300027742|Ga0209121_10259973 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 589 | Open in IMG/M |
3300027783|Ga0209448_10246752 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 589 | Open in IMG/M |
3300027824|Ga0209040_10099452 | Not Available | 1649 | Open in IMG/M |
3300027855|Ga0209693_10481754 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49 | 595 | Open in IMG/M |
3300027855|Ga0209693_10502024 | All Organisms → cellular organisms → Bacteria | 580 | Open in IMG/M |
3300027874|Ga0209465_10048993 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 2019 | Open in IMG/M |
3300027894|Ga0209068_10759906 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 570 | Open in IMG/M |
3300027910|Ga0209583_10031406 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1765 | Open in IMG/M |
3300027915|Ga0209069_10557163 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Ralstonia → Ralstonia solanacearum | 654 | Open in IMG/M |
3300027915|Ga0209069_10624234 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Accumulibacter → unclassified Candidatus Accumulibacter → Candidatus Accumulibacter sp. | 624 | Open in IMG/M |
3300027949|Ga0209860_1056368 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 521 | Open in IMG/M |
(restricted) 3300027997|Ga0255057_10060844 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1816 | Open in IMG/M |
(restricted) 3300027997|Ga0255057_10282563 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49 | 804 | Open in IMG/M |
3300028017|Ga0265356_1017734 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 770 | Open in IMG/M |
3300028598|Ga0265306_10138230 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 1273 | Open in IMG/M |
3300028717|Ga0307298_10017022 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1861 | Open in IMG/M |
3300028784|Ga0307282_10085494 | Not Available | 1449 | Open in IMG/M |
3300028787|Ga0307323_10259923 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 625 | Open in IMG/M |
3300028866|Ga0302278_10472452 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium | 538 | Open in IMG/M |
3300028889|Ga0247827_11040677 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 559 | Open in IMG/M |
3300029149|Ga0119977_100101 | Not Available | 1327 | Open in IMG/M |
3300029636|Ga0222749_10592152 | All Organisms → cellular organisms → Bacteria | 605 | Open in IMG/M |
3300029882|Ga0311368_10940012 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 576 | Open in IMG/M |
3300029945|Ga0311330_10076579 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 3459 | Open in IMG/M |
3300030659|Ga0316363_10262562 | Not Available | 699 | Open in IMG/M |
3300030659|Ga0316363_10282144 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 668 | Open in IMG/M |
3300030846|Ga0075403_10021864 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 537 | Open in IMG/M |
3300030939|Ga0138303_1418186 | Not Available | 536 | Open in IMG/M |
3300030943|Ga0311366_11699060 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 540 | Open in IMG/M |
3300030967|Ga0075399_11352047 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 636 | Open in IMG/M |
3300030998|Ga0073996_12294613 | Not Available | 1648 | Open in IMG/M |
3300031096|Ga0308193_1054268 | Not Available | 609 | Open in IMG/M |
3300031198|Ga0307500_10030004 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 1226 | Open in IMG/M |
3300031199|Ga0307495_10012483 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1283 | Open in IMG/M |
3300031226|Ga0307497_10157178 | Not Available | 949 | Open in IMG/M |
3300031344|Ga0265316_10662256 | Not Available | 737 | Open in IMG/M |
3300031565|Ga0307379_11451794 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 550 | Open in IMG/M |
3300031713|Ga0318496_10598214 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 609 | Open in IMG/M |
3300031718|Ga0307474_10051682 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae | 3034 | Open in IMG/M |
3300031718|Ga0307474_10136693 | Not Available | 1844 | Open in IMG/M |
3300031740|Ga0307468_102219688 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 531 | Open in IMG/M |
3300031768|Ga0318509_10073714 | Not Available | 1796 | Open in IMG/M |
3300031778|Ga0318498_10442668 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 575 | Open in IMG/M |
3300031788|Ga0302319_10233817 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylocystis | 2258 | Open in IMG/M |
3300031797|Ga0318550_10326936 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium mongolense → Rhizobium mongolense USDA 1844 | 744 | Open in IMG/M |
3300031804|Ga0310124_10625589 | Not Available | 618 | Open in IMG/M |
3300031820|Ga0307473_10565949 | Not Available | 779 | Open in IMG/M |
3300031820|Ga0307473_11265574 | Not Available | 551 | Open in IMG/M |
3300031831|Ga0318564_10395009 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 605 | Open in IMG/M |
3300031880|Ga0318544_10415908 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 523 | Open in IMG/M |
3300031912|Ga0306921_12042978 | Not Available | 609 | Open in IMG/M |
3300031945|Ga0310913_10056079 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria | 2585 | Open in IMG/M |
3300031945|Ga0310913_10117623 | Not Available | 1812 | Open in IMG/M |
3300031946|Ga0310910_11048437 | Not Available | 636 | Open in IMG/M |
3300031949|Ga0214473_10488579 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1376 | Open in IMG/M |
3300031954|Ga0306926_12933911 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 511 | Open in IMG/M |
3300032035|Ga0310911_10188933 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 1169 | Open in IMG/M |
3300032039|Ga0318559_10287193 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 763 | Open in IMG/M |
3300032053|Ga0315284_10967924 | Not Available | 963 | Open in IMG/M |
3300032054|Ga0318570_10029470 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 2164 | Open in IMG/M |
3300032059|Ga0318533_10149248 | Not Available | 1653 | Open in IMG/M |
3300032066|Ga0318514_10712906 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 533 | Open in IMG/M |
3300032089|Ga0318525_10071321 | All Organisms → cellular organisms → Bacteria | 1745 | Open in IMG/M |
3300032091|Ga0318577_10313542 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 750 | Open in IMG/M |
3300032122|Ga0310895_10338592 | All Organisms → cellular organisms → Bacteria | 722 | Open in IMG/M |
3300032160|Ga0311301_11789256 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 732 | Open in IMG/M |
3300032205|Ga0307472_100109930 | Not Available | 1920 | Open in IMG/M |
3300032205|Ga0307472_100866576 | All Organisms → cellular organisms → Bacteria | 832 | Open in IMG/M |
3300032260|Ga0316192_10782045 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium mongolense → Rhizobium mongolense USDA 1844 | 642 | Open in IMG/M |
3300032272|Ga0316189_10907794 | All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon | 668 | Open in IMG/M |
3300032272|Ga0316189_11078494 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium mongolense → Rhizobium mongolense USDA 1844 | 607 | Open in IMG/M |
3300032272|Ga0316189_11224613 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales | 566 | Open in IMG/M |
3300032770|Ga0335085_11288110 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium | 772 | Open in IMG/M |
3300032893|Ga0335069_10484672 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 1437 | Open in IMG/M |
3300033290|Ga0318519_10498211 | All Organisms → cellular organisms → Bacteria → Proteobacteria | 733 | Open in IMG/M |
3300033489|Ga0299912_10875651 | Not Available | 680 | Open in IMG/M |
3300034660|Ga0314781_085282 | All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei | 616 | Open in IMG/M |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
⦗Top⦘ |
Habitat | Taxonomy | Distribution |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 11.42% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil | 6.48% |
Vadose Zone Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil | 6.17% |
Tropical Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil | 4.63% |
Forest Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil | 4.01% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil | 3.70% |
Deep Subsurface | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface | 3.40% |
Watersheds | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds | 3.09% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 3.09% |
Peatlands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil | 3.09% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland | 2.78% |
Peatland | Environmental → Aquatic → Freshwater → Wetlands → Bog → Peatland | 2.47% |
Arctic Peat Soil | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil | 2.16% |
Hardwood Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil | 2.16% |
Tropical Peatland | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland | 2.16% |
Bog Forest Soil | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil | 1.54% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Soil | 1.54% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Soil | 1.54% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere | 1.54% |
Worm Burrow | Environmental → Aquatic → Marine → Coastal → Sediment → Worm Burrow | 1.23% |
Populus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere | 1.23% |
Groundwater Sediment | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment | 0.93% |
Soil | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Soil | 0.93% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural → Soil | 0.93% |
Soil | Environmental → Terrestrial → Soil → Loam → Forest Soil → Soil | 0.93% |
Groundwater Sand | Environmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand | 0.93% |
Bog | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Bog | 0.93% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere | 0.93% |
Freshwater Sediment | Environmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment | 0.62% |
Sediment | Environmental → Aquatic → Marine → Oceanic → Sediment → Sediment | 0.62% |
Marine Sediment | Environmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment | 0.62% |
Marine | Environmental → Aquatic → Marine → Unclassified → Unclassified → Marine | 0.62% |
Marine | Environmental → Aquatic → Marine → Oil Seeps → Unclassified → Marine | 0.62% |
Seawater | Environmental → Aquatic → Marine → Gulf → Unclassified → Seawater | 0.62% |
Sediment | Environmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment | 0.62% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil | 0.62% |
Agricultural Soil | Environmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil | 0.62% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil | 0.62% |
Soil | Environmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil | 0.62% |
Soil | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Soil | 0.62% |
Natural And Restored Wetlands | Environmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands | 0.62% |
Permafrost Soil | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil | 0.62% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.62% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere | 0.62% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere | 0.62% |
Attine Ant Fungus Gardens | Host-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens | 0.62% |
Watersheds | Environmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds | 0.31% |
Freshwater Lake Sediment | Environmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment | 0.31% |
Sediment | Environmental → Aquatic → Freshwater → Lake → Sediment → Sediment | 0.31% |
Bog | Environmental → Aquatic → Freshwater → Wetlands → Bog → Bog | 0.31% |
Soil | Environmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil | 0.31% |
Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 0.31% |
Marine | Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine | 0.31% |
Deep-Ocean Sediment | Environmental → Aquatic → Marine → Oceanic → Sediment → Deep-Ocean Sediment | 0.31% |
Seawater | Environmental → Aquatic → Marine → Inlet → Unclassified → Seawater | 0.31% |
Marine | Environmental → Aquatic → Marine → Intertidal Zone → Estuary → Marine | 0.31% |
Natural And Restored Wetlands | Environmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands | 0.31% |
Methane Seep Mesocosm | Environmental → Aquatic → Marine → Unclassified → Unclassified → Methane Seep Mesocosm | 0.31% |
Pelagic Marine | Environmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine | 0.31% |
Coastal Water And Sediment | Environmental → Aquatic → Marine → Neritic Zone → Unclassified → Coastal Water And Sediment | 0.31% |
Hydrothermal Vents | Environmental → Aquatic → Marine → Hydrothermal Vents → Black Smokers → Hydrothermal Vents | 0.31% |
Marine Sediment | Environmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment | 0.31% |
Sediment | Environmental → Aquatic → Marine → Sediment → Unclassified → Sediment | 0.31% |
Sediment | Environmental → Aquatic → Marine → Subtidal Zone → Sediment → Sediment | 0.31% |
Terrestrial Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil | 0.31% |
Grasslands Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil | 0.31% |
Grass Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil | 0.31% |
Permafrost | Environmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost | 0.31% |
Corn, Switchgrass And Miscanthus Rhizosphere | Environmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere | 0.31% |
Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil | 0.31% |
Permafrost | Environmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost | 0.31% |
Soil | Environmental → Terrestrial → Soil → Clay → Unclassified → Soil | 0.31% |
Fen | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Fen | 0.31% |
Palsa | Environmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa | 0.31% |
Biofilm | Environmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm | 0.31% |
Delisea Pulchra's Surface | Host-Associated → Algae → Red Algae → Ectosymbionts → Unclassified → Delisea Pulchra's Surface | 0.31% |
Delisea Pulchra | Host-Associated → Algae → Red Algae → Unclassified → Unclassified → Delisea Pulchra | 0.31% |
Corn Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere | 0.31% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere | 0.31% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere | 0.31% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere | 0.31% |
Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere | 0.31% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere | 0.31% |
Switchgrass Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere | 0.31% |
Miscanthus Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere | 0.31% |
Corn Rhizosphere | Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere | 0.31% |
Boreal Forest Soil | Environmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil | 0.31% |
Tropical Rainforest Soil | Environmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil | 0.31% |
Visualization |
---|
Powered by ApexCharts |
Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Taxon OID | Sample Name | Habitat Type | IMG/M Link |
---|---|---|---|
2140918005 | Marine sediment microbial communities from Arctic Ocean, off the coast from Alaska - sample from high methane PC12-225-485cm | Environmental | Open in IMG/M |
2170459024 | Grass soil microbial communities from Rothamsted Park, UK - FD1 (NaCl 300g/L 5ml) | Environmental | Open in IMG/M |
3300000189 | Delisea pulchra's surface microbial communities from Botany Bay, Sydney, Australia - BBAY58_SOAP_k21_Abyss_k53_GAA | Host-Associated | Open in IMG/M |
3300000242 | Marine microbial communities from chronically polluted sediments in Tierra del Fuego: Site OR sample ARG 05_12.3m | Environmental | Open in IMG/M |
3300000793 | Forest soil microbial communities from Amazon forest - 2010 replicate II A001 | Environmental | Open in IMG/M |
3300001083 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M1 | Environmental | Open in IMG/M |
3300001162 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M2 | Environmental | Open in IMG/M |
3300001179 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M3 | Environmental | Open in IMG/M |
3300001394 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210 deep-092012 | Environmental | Open in IMG/M |
3300001404 | Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-2 deep-072012 | Environmental | Open in IMG/M |
3300001593 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 | Environmental | Open in IMG/M |
3300001618 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF030 | Environmental | Open in IMG/M |
3300002921 | Delisea pulchra microbial communities from Sydney, Australia, affected by bleaching disease - 2012_BI_H8 | Host-Associated | Open in IMG/M |
3300003224 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM3 | Environmental | Open in IMG/M |
3300003861 | Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - CRP12 CR | Environmental | Open in IMG/M |
3300003885 | Black smoker hydrothermal vent sediment microbial communities from the Guaymas Basin, Mid-Atlantic Ridge, South Atlantic Ocean - Sample 1 | Environmental | Open in IMG/M |
3300004023 | Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Bullhead_CordA_D2 | Environmental | Open in IMG/M |
3300004099 | Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF236 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300004152 | Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3 | Environmental | Open in IMG/M |
3300004602 | Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 52 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300004633 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio | Environmental | Open in IMG/M |
3300005103 | Soil and rhizosphere microbial communities from Laval, Canada - mgLAA | Environmental | Open in IMG/M |
3300005158 | Soil and rhizosphere microbial communities from Laval, Canada - mgHAA | Environmental | Open in IMG/M |
3300005332 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly) | Environmental | Open in IMG/M |
3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Host-Associated | Open in IMG/M |
3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Host-Associated | Open in IMG/M |
3300005363 | Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Environmental | Open in IMG/M |
3300005590 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd47.2 | Environmental | Open in IMG/M |
3300005612 | Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd00.2 | Environmental | Open in IMG/M |
3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Host-Associated | Open in IMG/M |
3300005713 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2) | Environmental | Open in IMG/M |
3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Host-Associated | Open in IMG/M |
3300005764 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2) | Environmental | Open in IMG/M |
3300005953 | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S23_td_Bottom_ad_3770_LV_A | Environmental | Open in IMG/M |
3300005994 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049 | Environmental | Open in IMG/M |
3300005995 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 | Environmental | Open in IMG/M |
3300006047 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 | Environmental | Open in IMG/M |
3300006102 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013 | Environmental | Open in IMG/M |
3300006162 | Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012 | Environmental | Open in IMG/M |
3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Environmental | Open in IMG/M |
3300006174 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014 | Environmental | Open in IMG/M |
3300006176 | Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 | Environmental | Open in IMG/M |
3300006235 | Marine sediment microbial communities, 33.9 km from oil contamination, ambient, Gulf of Mexico ? BC463 | Environmental | Open in IMG/M |
3300006354 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 | Environmental | Open in IMG/M |
3300006465 | Deep-sea sediment bacterial and archaeal communities from Fram Strait - Hausgarten IX | Environmental | Open in IMG/M |
3300006606 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMA (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300006755 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA Plitter | Environmental | Open in IMG/M |
3300006792 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL1-D | Environmental | Open in IMG/M |
3300006844 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Host-Associated | Open in IMG/M |
3300006854 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4 | Host-Associated | Open in IMG/M |
3300006864 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 3 DNA2013-193 | Environmental | Open in IMG/M |
3300006953 | Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300007255 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 | Environmental | Open in IMG/M |
3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Environmental | Open in IMG/M |
3300008470 | Sediment core microbial communities from Adelie Basin, Antarctica. Combined Assembly of Gp0136540, Gp0136562, Gp0136563 | Environmental | Open in IMG/M |
3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Host-Associated | Open in IMG/M |
3300009038 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaG | Environmental | Open in IMG/M |
3300009089 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaG | Environmental | Open in IMG/M |
3300009147 | Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) | Host-Associated | Open in IMG/M |
3300009156 | Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2) | Host-Associated | Open in IMG/M |
3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Host-Associated | Open in IMG/M |
3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Host-Associated | Open in IMG/M |
3300009488 | Deep subsurface microbial communities from Indian Ocean to uncover new lineages of life (NeLLi) - Sumatra_00607 metaG | Environmental | Open in IMG/M |
3300009519 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_150 | Environmental | Open in IMG/M |
3300009525 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaG | Environmental | Open in IMG/M |
3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Host-Associated | Open in IMG/M |
3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Host-Associated | Open in IMG/M |
3300009641 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_150 | Environmental | Open in IMG/M |
3300009643 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_40 | Environmental | Open in IMG/M |
3300009645 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40 | Environmental | Open in IMG/M |
3300009646 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_150 | Environmental | Open in IMG/M |
3300009661 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-062 | Environmental | Open in IMG/M |
3300009672 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaG | Environmental | Open in IMG/M |
3300009683 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaG | Environmental | Open in IMG/M |
3300009817 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_10_20 | Environmental | Open in IMG/M |
3300010043 | Tropical forest soil microbial communities from Panama - MetaG Plot_26 | Environmental | Open in IMG/M |
3300010047 | Tropical forest soil microbial communities from Panama - MetaG Plot_30 | Environmental | Open in IMG/M |
3300010147 | Soil microbial communities from California, USA to study soil gas exchange rates - BB-CA-RED metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300010358 | Tropical forest soil microbial communities from Panama - MetaG Plot_3 | Environmental | Open in IMG/M |
3300010359 | Tropical forest soil microbial communities from Panama - MetaG Plot_15 | Environmental | Open in IMG/M |
3300010360 | Tropical forest soil microbial communities from Panama - MetaG Plot_6 | Environmental | Open in IMG/M |
3300010361 | Tropical forest soil microbial communities from Panama - MetaG Plot_23 | Environmental | Open in IMG/M |
3300010362 | Tropical forest soil microbial communities from Panama - MetaG Plot_22 | Environmental | Open in IMG/M |
3300010376 | Tropical forest soil microbial communities from Panama - MetaG Plot_28 | Environmental | Open in IMG/M |
3300010379 | Sb_50d combined assembly | Environmental | Open in IMG/M |
3300010397 | Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4 | Environmental | Open in IMG/M |
3300010398 | Tropical forest soil microbial communities from Panama - MetaG Plot_35 | Environmental | Open in IMG/M |
3300010866 | Boreal forest soil eukaryotic communities from Alaska, USA - C1-3 Metatranscriptome (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300010868 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (PacBio error correction) | Environmental | Open in IMG/M |
3300011120 | Combined assembly of Microbial Forest Soil metaT | Environmental | Open in IMG/M |
3300011415 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT469_2 | Environmental | Open in IMG/M |
3300011439 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT820_2 | Environmental | Open in IMG/M |
3300012096 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaG | Environmental | Open in IMG/M |
3300012177 | Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ027 MetaG | Host-Associated | Open in IMG/M |
3300012200 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaG | Environmental | Open in IMG/M |
3300012201 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaG | Environmental | Open in IMG/M |
3300012210 | Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaG | Environmental | Open in IMG/M |
3300012226 | Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT400_2 | Environmental | Open in IMG/M |
3300012362 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaG | Environmental | Open in IMG/M |
3300012395 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_8_1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300012677 | Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ012 MetaG | Host-Associated | Open in IMG/M |
3300012685 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaG | Environmental | Open in IMG/M |
3300012917 | Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaG | Environmental | Open in IMG/M |
3300012927 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012944 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300012971 | Tropical forest soil microbial communities from Panama - MetaG Plot_1 | Environmental | Open in IMG/M |
3300012984 | Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MG | Environmental | Open in IMG/M |
3300013098 | Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay11, Core 4567-28, 0-3 cm | Environmental | Open in IMG/M |
3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Host-Associated | Open in IMG/M |
3300013763 | Permafrost microbial communities from Nunavut, Canada - A15_65cm_0M | Environmental | Open in IMG/M |
3300014159 | Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_60_metaG | Environmental | Open in IMG/M |
3300014272 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_CattailB_D1 | Environmental | Open in IMG/M |
3300014501 | Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly) | Environmental | Open in IMG/M |
3300016294 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 | Environmental | Open in IMG/M |
3300016319 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H | Environmental | Open in IMG/M |
3300016341 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 | Environmental | Open in IMG/M |
3300016371 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172 | Environmental | Open in IMG/M |
3300016387 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 | Environmental | Open in IMG/M |
3300016422 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111 | Environmental | Open in IMG/M |
3300017926 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2 | Environmental | Open in IMG/M |
3300017959 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MG | Environmental | Open in IMG/M |
3300018007 | Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5 | Environmental | Open in IMG/M |
3300018008 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_40 | Environmental | Open in IMG/M |
3300018019 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_150 | Environmental | Open in IMG/M |
3300018020 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_100 | Environmental | Open in IMG/M |
3300018022 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_40 | Environmental | Open in IMG/M |
3300018029 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP06_20_MG | Environmental | Open in IMG/M |
3300018032 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP10_20_MG | Environmental | Open in IMG/M |
3300018033 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10 | Environmental | Open in IMG/M |
3300018034 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10 | Environmental | Open in IMG/M |
3300018035 | Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10 | Environmental | Open in IMG/M |
3300018058 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MG | Environmental | Open in IMG/M |
3300018060 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MG | Environmental | Open in IMG/M |
3300018062 | Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MG | Environmental | Open in IMG/M |
3300018466 | Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 T | Environmental | Open in IMG/M |
3300018468 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111 | Environmental | Open in IMG/M |
3300019194 | Soil microbial communities from Bohemian Forest, Czech Republic ? CSE1 metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019232 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT530_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019248 | Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT660_2_16_1Ra (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019256 | Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_10_metaT (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300019789 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction) | Environmental | Open in IMG/M |
3300020140 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300020231 | Deep-sea sediment microbial communities from the Mariana Trench, Pacific Ocean - CR04 | Environmental | Open in IMG/M |
3300020447 | Marine microbial communities from Tara Oceans - TARA_B100000745 (ERX556090-ERR599159) | Environmental | Open in IMG/M |
3300020579 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-M | Environmental | Open in IMG/M |
3300021078 | Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redo | Environmental | Open in IMG/M |
3300021086 | Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly) | Environmental | Open in IMG/M |
3300021178 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-M | Environmental | Open in IMG/M |
3300021420 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-M | Environmental | Open in IMG/M |
3300021432 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M | Environmental | Open in IMG/M |
3300021475 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O | Environmental | Open in IMG/M |
3300021476 | Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2) | Environmental | Open in IMG/M |
3300021478 | Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-M | Environmental | Open in IMG/M |
3300021560 | Tropical forest soil microbial communities from Panama - MetaG Plot_4 | Environmental | Open in IMG/M |
3300021860 | Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2014 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300022413 | Sediment microbial communities from San Francisco Bay, California, United States - SF_Jan12_sed_USGS_21 | Environmental | Open in IMG/M |
3300022532 | Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-M (Metagenome Metatranscriptome) (v2) | Environmental | Open in IMG/M |
3300024058 | Deep subsurface microbial communities from Mariana Trench to uncover new lineages of life (NeLLi) - CR04 metaG (SPAdes) | Environmental | Open in IMG/M |
3300024060 | Deep subsurface microbial communities from Kermadec Trench to uncover new lineages of life (NeLLi) - N074 metaG (SPAdes) | Environmental | Open in IMG/M |
3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Host-Associated | Open in IMG/M |
3300024265 | Deep subsurface microbial communities from Indian Ocean to uncover new lineages of life (NeLLi) - Sumatra_00157 metaG (SPAdes) | Environmental | Open in IMG/M |
3300024302 (restricted) | Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_124_October2016_200_MG | Environmental | Open in IMG/M |
3300024429 | Deep subsurface microbial communities from South Pacific Ocean to uncover new lineages of life (NeLLi) - Chile_00310 metaG (SPAdes) | Environmental | Open in IMG/M |
3300024432 | Deep subsurface microbial communities from Indian Ocean to uncover new lineages of life (NeLLi) - Sumatra_00607 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025453 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_40 (SPAdes) | Environmental | Open in IMG/M |
3300025501 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_150 (SPAdes) | Environmental | Open in IMG/M |
3300025507 | Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_40 (SPAdes) | Environmental | Open in IMG/M |
3300025582 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost154B-two (SPAdes) | Environmental | Open in IMG/M |
3300025693 | Methane-oxidizing microbial communities from mesocosms in the Gulf of Mexico - GOM15C Gulf of Mexico (SPAdes) | Environmental | Open in IMG/M |
3300025725 | Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0002-211 (SPAdes) | Environmental | Open in IMG/M |
3300025809 | Pelagic marine microbial communities from North Sea - COGITO_mtgs_110523 (SPAdes) | Environmental | Open in IMG/M |
3300025891 | Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost154B-one (SPAdes) | Environmental | Open in IMG/M |
3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) | Environmental | Open in IMG/M |
3300025930 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) | Environmental | Open in IMG/M |
3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026046 | Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleC_D1 (SPAdes) | Environmental | Open in IMG/M |
3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) | Host-Associated | Open in IMG/M |
3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) | Host-Associated | Open in IMG/M |
3300026221 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-062 (SPAdes) | Environmental | Open in IMG/M |
3300026294 | Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 (SPAdes) | Environmental | Open in IMG/M |
3300026296 | Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes) | Environmental | Open in IMG/M |
3300026354 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-04-B | Environmental | Open in IMG/M |
3300026355 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-02-A | Environmental | Open in IMG/M |
3300026481 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-19-A | Environmental | Open in IMG/M |
3300026494 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-07-A | Environmental | Open in IMG/M |
3300026496 | Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-69-A | Environmental | Open in IMG/M |
3300026746 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G06K2-12 (SPAdes) | Environmental | Open in IMG/M |
3300026810 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 16 (SPAdes) | Environmental | Open in IMG/M |
3300026857 | Soil and rhizosphere microbial communities from Laval, Canada - mgLMB (SPAdes) | Environmental | Open in IMG/M |
3300026865 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 75 (SPAdes) | Environmental | Open in IMG/M |
3300026909 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 23 (SPAdes) | Environmental | Open in IMG/M |
3300027013 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_30_40 (SPAdes) | Environmental | Open in IMG/M |
3300027014 | Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 4 (SPAdes) | Environmental | Open in IMG/M |
3300027307 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_O2 (SPAdes) | Environmental | Open in IMG/M |
3300027461 | Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-ROWE15-E (SPAdes) | Environmental | Open in IMG/M |
3300027497 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG (SPAdes) | Environmental | Open in IMG/M |
3300027502 | Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027527 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 6 MoBio (SPAdes) | Environmental | Open in IMG/M |
3300027537 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027570 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG (SPAdes) | Environmental | Open in IMG/M |
3300027583 | Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027643 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes) | Environmental | Open in IMG/M |
3300027645 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 (SPAdes) | Environmental | Open in IMG/M |
3300027655 | Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes) | Environmental | Open in IMG/M |
3300027678 | Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3 (SPAdes) | Environmental | Open in IMG/M |
3300027698 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM2 (SPAdes) | Environmental | Open in IMG/M |
3300027725 | Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes) | Environmental | Open in IMG/M |
3300027742 | Oil polluted marine microbial communities from Coal Oil Point, Santa Barbara, California, USA - Sample 3 (SPAdes) | Environmental | Open in IMG/M |
3300027783 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes) | Environmental | Open in IMG/M |
3300027824 | Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes) | Environmental | Open in IMG/M |
3300027855 | Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes) | Environmental | Open in IMG/M |
3300027874 | Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes) | Environmental | Open in IMG/M |
3300027894 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes) | Environmental | Open in IMG/M |
3300027910 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes) | Environmental | Open in IMG/M |
3300027915 | Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes) | Environmental | Open in IMG/M |
3300027949 | Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_40_50 (SPAdes) | Environmental | Open in IMG/M |
3300027997 (restricted) | Seawater microbial communities from Amundsen Gulf, Northwest Territories, Canada - Cases_109_6 | Environmental | Open in IMG/M |
3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Host-Associated | Open in IMG/M |
3300028598 | Marine sediment microbial communities from subtidal zone of North Sea - Hel_20160420 (Illumina Assembly) | Environmental | Open in IMG/M |
3300028717 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_158 | Environmental | Open in IMG/M |
3300028784 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121 | Environmental | Open in IMG/M |
3300028787 | Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381 | Environmental | Open in IMG/M |
3300028866 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N3_2 | Environmental | Open in IMG/M |
3300028889 | Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day2 | Environmental | Open in IMG/M |
3300029149 | Marine sediment microbial communities from University of Hong Kong - Deep-ocean Sediment | Environmental | Open in IMG/M |
3300029636 | Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300029882 | III_Palsa_E1 coassembly | Environmental | Open in IMG/M |
3300029945 | I_Bog_N2 coassembly | Environmental | Open in IMG/M |
3300030659 | Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2) | Environmental | Open in IMG/M |
3300030846 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FB5 EcM (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030939 | Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A9_MS_spring Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2) | Environmental | Open in IMG/M |
3300030943 | III_Fen_N2 coassembly | Environmental | Open in IMG/M |
3300030967 | Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA11 Emin (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300030998 | Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-3A (Eukaryote Community Metatranscriptome) | Environmental | Open in IMG/M |
3300031096 | Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_194 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
3300031198 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 14_S | Environmental | Open in IMG/M |
3300031199 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 7_S | Environmental | Open in IMG/M |
3300031226 | Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_S | Environmental | Open in IMG/M |
3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Host-Associated | Open in IMG/M |
3300031565 | Soil microbial communities from Risofladan, Vaasa, Finland - UN-2 | Environmental | Open in IMG/M |
3300031713 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22 | Environmental | Open in IMG/M |
3300031718 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05 | Environmental | Open in IMG/M |
3300031740 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05 | Environmental | Open in IMG/M |
3300031768 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22 | Environmental | Open in IMG/M |
3300031778 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24 | Environmental | Open in IMG/M |
3300031788 | Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_2 | Environmental | Open in IMG/M |
3300031797 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23 | Environmental | Open in IMG/M |
3300031804 | Marine microbial communities from Western Arctic Ocean, Canada - CB11b_AW_Bot5 | Environmental | Open in IMG/M |
3300031820 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515 | Environmental | Open in IMG/M |
3300031831 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20 | Environmental | Open in IMG/M |
3300031880 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25 | Environmental | Open in IMG/M |
3300031912 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2) | Environmental | Open in IMG/M |
3300031945 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082 | Environmental | Open in IMG/M |
3300031946 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172 | Environmental | Open in IMG/M |
3300031949 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197 | Environmental | Open in IMG/M |
3300031954 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2) | Environmental | Open in IMG/M |
3300032035 | Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170 | Environmental | Open in IMG/M |
3300032039 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21 | Environmental | Open in IMG/M |
3300032053 | Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16 | Environmental | Open in IMG/M |
3300032054 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23 | Environmental | Open in IMG/M |
3300032059 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27 | Environmental | Open in IMG/M |
3300032066 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18 | Environmental | Open in IMG/M |
3300032089 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23 | Environmental | Open in IMG/M |
3300032091 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25 | Environmental | Open in IMG/M |
3300032122 | Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D4 | Environmental | Open in IMG/M |
3300032160 | Sb_50d combined assembly (MetaSPAdes) | Environmental | Open in IMG/M |
3300032205 | Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05 | Environmental | Open in IMG/M |
3300032260 | Coastal sediment microbial communities from Maine, United States - Merrow Island worm burrow | Environmental | Open in IMG/M |
3300032272 | Coastal sediment microbial communities from Maine, United States - Lowes Cove worm burrow | Environmental | Open in IMG/M |
3300032770 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5 | Environmental | Open in IMG/M |
3300032893 | Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1 | Environmental | Open in IMG/M |
3300033290 | Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15 | Environmental | Open in IMG/M |
3300033489 | Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT95D214 | Environmental | Open in IMG/M |
3300034660 | Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60R2 (Metagenome Metatranscriptome) | Environmental | Open in IMG/M |
Geographical Distribution | |
---|---|
Zoom: | Powered by OpenStreetMap |
⦗Top⦘ |
Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).
Protein ID | Sample Taxon ID | Habitat | Sequence |
ASHM485C_05057250 | 2140918005 | Coastal Water And Sediment | GSSSGIDPKPLQAAVVKSDGGERCRNAGTKIPAGTVEGGERKRTTAEASKAD |
FD1_10072560 | 2170459024 | Grass Soil | ALRGRQSGVDLKPPQAAVVKSDGGERCGNAGDRIPAGTVERGERKRTAAEVSKAV |
BBAY58_100286853 | 3300000189 | Delisea Pulchra's Surface | VVKSAGGERCGNVGTKIPSGTVERGERKRTIAEVSKAV* |
TDF_OR_ARG05_123mDRAFT_10746112 | 3300000242 | Marine | GTDPKPPQTAVVKSDGGERCGNAGTMIPTGKVERGERKRTTAEVS* |
AF_2010_repII_A001DRAFT_100825122 | 3300000793 | Forest Soil | AVVKSDGGERCGRAGTMFPAGMVERGERKQTADEVSKRD* |
JGI12678J13193_10058902 | 3300001083 | Forest Soil | AAVVKSDGGERCGKVGTKIPIGMIERGERKRTVDEVSKAV* |
JGI12714J13572_10081661 | 3300001162 | Forest Soil | ADLKPPQAASVKSRGWERCGNAGTMIPAGMVERGERKQTVDEVSKAD* |
JGI12660J13575_1002501 | 3300001179 | Forest Soil | HGGERCGNVGTMIPAGTVERGERKRTVDEVSKAD* |
JGI20191J14862_10535781 | 3300001394 | Arctic Peat Soil | ALRGRQSGVDLKPPQAAVVKSHGGERCGKAGTXILAGMIERGERKRTAVEVSKSGLDDVKTGG* |
JGI20181J14860_10116622 | 3300001404 | Arctic Peat Soil | AASVKSRGRERCGNAETMIPAGMVERGERKQTVDEVSKAD* |
JGI12635J15846_108724041 | 3300001593 | Forest Soil | DPKPPRAALVKSHGGERCGNVGTMIPTGTVERGERKRTVDEVSKAD* |
JGI20264J16347_101612 | 3300001618 | Forest Soil | LRVRQSGADLKPPQAASVKSRGWERCGNAGTMIPAGMVERGERKQTVDEVSKAD* |
BIH8_100127242 | 3300002921 | Delisea Pulchra | LSGIDPKPPQAAVVKSDGGERCGNVGTKIPSGTVERGERKRTIAEVSKAV* |
JGI26344J46810_10187711 | 3300003224 | Bog Forest Soil | ADPKPPQAAVVKSDGGERCGNVGAMIPAGTVERGERKQTASEASKAD* |
Ga0031654_102152082 | 3300003861 | Freshwater Lake Sediment | QVADPKPPQAAVVKSDGGERCGNVGALIPAGKIERGERKQTASEASKAD* |
Ga0063294_105865941 | 3300003885 | Hydrothermal Vents | VDPKLPQATVVKSHGGERCGKVGTTIPASTVERGERKRTTAEVSKAD* |
Ga0055441_101728712 | 3300004023 | Natural And Restored Wetlands | KPLQAAVVKSDGGERCRNAGAKIPAGTVEGGERKRTTAEASKAD* |
Ga0058900_14251392 | 3300004099 | Forest Soil | AAVKSRGGERRGNAGTMIPAGMVERGERKQTASEASKAD* |
Ga0062386_1015327471 | 3300004152 | Bog Forest Soil | KPPQAAVVKSDGGERCGNARAMILAGKVERGERERTVDEVSKAV* |
Ga0068960_12723782 | 3300004602 | Peatlands Soil | AAAVKSRGGERRGNAGTMIPAGKIERGERKQTASEASKAD* |
Ga0066395_100212911 | 3300004633 | Tropical Forest Soil | LSSKSDGGERCRKVGTMIPAGKVERGERKQTASEASKAD* |
Ga0066395_100376163 | 3300004633 | Tropical Forest Soil | AVVKSDGGERCGNVGAMISAGKIERGERKQTASEASKSD* |
Ga0066813_10156571 | 3300005103 | Soil | KPPQAAVVKSDGGERCGKVGATIPAGKVERGERKRIVDEVSKAD* |
Ga0066816_10191422 | 3300005158 | Soil | ADPKPPQAAAVKSHGSERRGKARTMIPAGKVERGERKRTVREVSKAD* |
Ga0066388_1042934821 | 3300005332 | Tropical Forest Soil | MALRVRQSGADPKPPQAAAVKSRGGERCGNAGTMIPAGMVDGGERKRTAAEASKAD* |
Ga0066388_1057130783 | 3300005332 | Tropical Forest Soil | PKPPQAAAVKSRGGERCGNVGTVIPAGVVEGGERKRTAAEASKAD* |
Ga0066388_1067642441 | 3300005332 | Tropical Forest Soil | PPQAAAVKSRGGERCGNVGTVIPAGKVEGGERKRTAAEASKGCLGDVETAG* |
Ga0070661_1002345782 | 3300005344 | Corn Rhizosphere | QSGSGLKPLQAAVVKSDGSERCSQRHEDIPAGEVERGERKRTADELSKAD* |
Ga0070674_1018318631 | 3300005356 | Miscanthus Rhizosphere | PKPPRAAAVKSRGGERRGNAWTMIPAGMVERGERKQTASEASKAD* |
Ga0008090_157049233 | 3300005363 | Tropical Rainforest Soil | KPPQAAAVKCRGGERCGNAGTMIPAGKVERGERKQTVDEVSKAD* |
Ga0070711_1000658313 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | ALVKSHGGERCGNVGTMIPAGTVERGERKRTVDEVSKAD* |
Ga0070711_1007140992 | 3300005439 | Corn, Switchgrass And Miscanthus Rhizosphere | PKPPRAAAVKSRGGERRGNAGTMIPAGKVERGERKQTASEASKAVR* |
Ga0070727_107528801 | 3300005590 | Marine Sediment | VVKSHGSERCGKVETMISASTVERGERKRTTAEVSKAA* |
Ga0070723_105685373 | 3300005612 | Marine Sediment | LQAAVVKSDGGERQKSRGKIPAGKVQRGERERTVDEVSKAD* |
Ga0068856_1023606301 | 3300005614 | Corn Rhizosphere | VKSHGGERCGNVGTMIPAGTVERGERKRTVDEVSKAD* |
Ga0066905_1000162491 | 3300005713 | Tropical Forest Soil | VAKYHGGERLRKRWDKIPAGMVEGGERKQTADELSKTD* |
Ga0068861_1026496052 | 3300005719 | Switchgrass Rhizosphere | SRGGERCGNAGTMIPAGTVERGERKRTVSEVSKAD* |
Ga0066903_1006832724 | 3300005764 | Tropical Forest Soil | ADPKPPQAAAVKSRGGERCGKAGTMIPTGKVERGERKRTVR* |
Ga0066903_1054606091 | 3300005764 | Tropical Forest Soil | RGGERRGNAGTMIPAGKVERGERKQTASEASKAD* |
Ga0066383_100332424 | 3300005953 | Marine | QAAVVKSDGGERCGNAGAMTLAGTVERGERKRTTAEVSKAD* |
Ga0066789_101979263 | 3300005994 | Soil | PKPPQAALVKSHGGERCGNVGTMIPAGTVERGERKRTVDAVSKAD* |
Ga0066790_103845661 | 3300005995 | Soil | PQAAAIKCRGGERCGNAGTMIAAGKVERGERKQTVDEVSKAD* |
Ga0066790_105110832 | 3300005995 | Soil | QAALVKSHGGERCGNAGTVIPAGTVERGERKRTVDEVSK* |
Ga0075024_1000624052 | 3300006047 | Watersheds | SRGGERRGNVGTMIPAGKVERGERKQTASEASKAD* |
Ga0075024_1005315461 | 3300006047 | Watersheds | AVVKSDGGERCRKVGTMIPAGKVERGERKQTASEASKSV* |
Ga0075015_1004016312 | 3300006102 | Watersheds | RGCERCGNAGTMIPAGMVERGERKQTVDEVSKAD* |
Ga0075030_1001879271 | 3300006162 | Watersheds | VKSNGGERCGSAGTMIPAGTVERGERKQTADEVSKRE* |
Ga0070715_107211511 | 3300006163 | Corn, Switchgrass And Miscanthus Rhizosphere | FGDQVADPKPLQAAVVKSVGGERCRKVGTMIPAGKVERGERKQTK* |
Ga0075014_1009046542 | 3300006174 | Watersheds | KSDGGERCRNVGTMIPAGMMWEGERKQTAAEASKAE* |
Ga0070765_1016701462 | 3300006176 | Soil | YRGGERCGNAGTMIPAGKVERGERKQTVEEVSKAD* |
Ga0082395_10319652 | 3300006235 | Marine | DPKPLQAAVVKSDGGERCRKVGTKIPAGKAQRGERKRTADEVSKAD* |
Ga0075021_108896823 | 3300006354 | Watersheds | VKSLGGERCGNAGAMILAGEVERGKRKRTADEVSNAD* |
Ga0082250_100018002 | 3300006465 | Sediment | VQRSGADPKLPQAAVVKSHGGERCGKVGTTIPASTVERGERKRTTAEVSKAD* |
Ga0074062_130013993 | 3300006606 | Soil | VKSHGGERCGNAGTMIPAGTVERGERKRTVSEVSKAD* |
Ga0079222_100109005 | 3300006755 | Agricultural Soil | AAVAKYHGGERLRKRWDKIPAGMVEGGERKQTADEVSKRG* |
Ga0075530_10679872 | 3300006792 | Arctic Peat Soil | MKEGPSGSVAGIDLKPLQAAVVKSDGGERCRNAGAKIPAGTVEGGERKRTTAEASKAD* |
Ga0075428_1014327691 | 3300006844 | Populus Rhizosphere | KPPQAAAVKSRGGERCGNAGTMIPAGTVEGGERKRTAAEASKSD* |
Ga0075425_1028461652 | 3300006854 | Populus Rhizosphere | ADPKPPQAAVVKSDGGERCGKVGATVPAGKVERGERKRIVDEVSKAD* |
Ga0066797_12789702 | 3300006864 | Soil | PKPPRAALVKSHGGERRGNVGTMIPAGTVERGERKRTVDEVSKAD* |
Ga0074063_142758352 | 3300006953 | Soil | GADLKPPQAAAVKSRGGERCGNAGTMIPAGTVERGERKQTVDEVSKAV* |
Ga0099791_101178491 | 3300007255 | Vadose Zone Soil | AHTSDRGERCRKVGTMIPAGKVERGERKQTASEASKSD* |
Ga0099791_105076931 | 3300007255 | Vadose Zone Soil | VLIPSHQQAAAVKRRGGERCGNAGTMIPAGKVERGERKQTVDEVSKAD* |
Ga0099795_100977913 | 3300007788 | Vadose Zone Soil | ADPKPPQAAVVKSHGGERCGNAGTMIPAGTVERGERKQTVSEVSKAD* |
Ga0115371_100463802 | 3300008470 | Sediment | PQAAVVKSHGGERCGKVETMISASTVERGKRKRTTSEVSKAD* |
Ga0115371_101768521 | 3300008470 | Sediment | LRDRSSETGPKPPQAAVVKSDGGKRCGKAGTMIPAGMVERGERKRTAVDVSKIP* |
Ga0105244_102702132 | 3300009036 | Miscanthus Rhizosphere | LRVRQSGADPKPLQAAAVKSRGGERCSQVWAKAQAVERGERKQTVDEVSKAD* |
Ga0099829_106423951 | 3300009038 | Vadose Zone Soil | RGRQSGAGLKPLQAAVVKSDGSERCSQRRDDIPAGEVERGERKRTVDEVSKAD* |
Ga0099828_115478621 | 3300009089 | Vadose Zone Soil | KSHGGERCGKVGTMIPAGKVERGERKQTASEASKAD* |
Ga0114129_104942641 | 3300009147 | Populus Rhizosphere | KPPQAAAVKSRGGERCGNVGTMNPAGMVERGERKRTAAEVSKAD* |
Ga0111538_103645931 | 3300009156 | Populus Rhizosphere | KPLQAAAVKSRGGERCSQVWAKAQAVERGERKQTVDEVSKAD* |
Ga0105241_118822051 | 3300009174 | Corn Rhizosphere | KSRGGERCGKVGTMIPAGMVERGERKQTAAESAYV* |
Ga0105248_101523135 | 3300009177 | Switchgrass Rhizosphere | DPKPPRAALVKSHGGERCGNVGTMIPAGTVERGERKRTVDEVSKAD* |
Ga0105248_102623562 | 3300009177 | Switchgrass Rhizosphere | ALRVRRSGADPKPPQAAAVKSRGGERCGNAGTMIPAGTVERGERKRTVDEVSKAV* |
Ga0114925_103392261 | 3300009488 | Deep Subsurface | PQTAVVKSDGGERCGNAGTMIPAGTVEGGERKRTTAEAS* |
Ga0114925_109982591 | 3300009488 | Deep Subsurface | VKSHGSERCGKVGTMIPASTVERGERKRTTSEVSKAD* |
Ga0116108_11981171 | 3300009519 | Peatland | KSHGGERRGNAGTMISAGTVERGERKRTVDEVCRNRIR* |
Ga0116220_102457611 | 3300009525 | Peatlands Soil | QVADPKPPQAAVVKSDGGERCGNVGAMIPAGKIERGERKQTASEASKAV* |
Ga0105237_113997441 | 3300009545 | Corn Rhizosphere | PPQAVVVKINGGERCGSAGTMIPAGTVERGERKQTADEVSKRD* |
Ga0105249_127053131 | 3300009553 | Switchgrass Rhizosphere | KPPRAALVKSHGGERCGNVGTMIPAGTAEGGERKRTVDEVSKAD* |
Ga0116120_10917411 | 3300009641 | Peatland | AAAVKSRGSERCGNAGTKILAGKVERGERKRTAAEASKAD* |
Ga0116120_11703182 | 3300009641 | Peatland | LKPPQAAVVKSDGGERCGKVGTKILTGTVERGERKQTADEVSKAD* |
Ga0116110_11289943 | 3300009643 | Peatland | RQSGADFKPPQAAVVKSNGGERCGSRDMIPAGTVERGERKQTADEVSKTD* |
Ga0116106_11974051 | 3300009645 | Peatland | AAAAKCRGGERCGNTGTMIPAGTVERGERKQTVDEVSKAD* |
Ga0116132_10692451 | 3300009646 | Peatland | QVADPKPPRAAAVKSRGGERRGNVGTMIPAGKVERGERKQTASEASKAD* |
Ga0105858_10969121 | 3300009661 | Permafrost Soil | VADPKPPRAALVKSHGGERCGNVGTMIPAGTVERGERKRTVDEVSKAD* |
Ga0116215_10586812 | 3300009672 | Peatlands Soil | KSDGGERCRKVGTMIPAGKVERGERKQTASEASKSD* |
Ga0116224_104272311 | 3300009683 | Peatlands Soil | QVADPKPPQAAVVKSDGGERCGKVGTRIPAGKVERGERKRTAAEVSKAD* |
Ga0105062_11248862 | 3300009817 | Groundwater Sand | PPQAAAVKSRGGERCGNAGTMIPAGTVERGERKRTADEVSKAD* |
Ga0126380_100748221 | 3300010043 | Tropical Forest Soil | PKPLQAAVVKSDGGERCRKVGTMIPAGQVERGERKQTASEASKSD* |
Ga0126380_101573941 | 3300010043 | Tropical Forest Soil | KPPQAAAVKSRGGERCGKAGTMIPTGKVERGERKRTVDEVSKRD* |
Ga0126380_120586372 | 3300010043 | Tropical Forest Soil | PKPLQAAVVKSDGGERCRKVGTMIPAGKVERGERKQTASEASKAD* |
Ga0126382_121131231 | 3300010047 | Tropical Forest Soil | LVKSQGGERCGNVGTMIPAGTVERGERKRTVDEVSKAD* |
Ga0126382_121487861 | 3300010047 | Tropical Forest Soil | AEPKPLQAAAVKCRGGERCSQGSDISLAGGIEGGERKRTAAEASKAD* |
Ga0126319_15576932 | 3300010147 | Soil | DLKPPQAAVVKSHGGERCGKVGTMIPTGMIERGERKRTVSEVSKCD* |
Ga0126370_123724661 | 3300010358 | Tropical Forest Soil | LQAAVVKSDGGERCRKVGTMIPAGKVERGERKQTASEASKAD* |
Ga0126376_101067681 | 3300010359 | Tropical Forest Soil | PKPLQAAVVKSDGGERCRKVGTMIPAGKVEGGERKQTDSEASKAD* |
Ga0126376_112913023 | 3300010359 | Tropical Forest Soil | PLQAAVVKSDGGERCRKVGTMIPAGKVERGERKQTASEASKSD* |
Ga0126376_117095602 | 3300010359 | Tropical Forest Soil | LKPPQAAVVKSHGGERCGKVGTMIPAGMVEGGERKRTAAEVSKGD* |
Ga0126372_103331541 | 3300010360 | Tropical Forest Soil | SRGGERCGNVGTVIPAGKVEGGERKRTAAEASKAD* |
Ga0126372_112138191 | 3300010360 | Tropical Forest Soil | VKRRGGERCGNAGTMIPAGKVERGERKQTVDEVSKAD* |
Ga0126372_112618721 | 3300010360 | Tropical Forest Soil | QAAAVKSRGGERCGKRRDKIPAGTVERGERKRTAAEVSKAD* |
Ga0126378_128880481 | 3300010361 | Tropical Forest Soil | RQSGVDLKPPQVASVKSRGDERCGNAGTMIPAGTVERGERKRTAAEASKAD* |
Ga0126377_130422252 | 3300010362 | Tropical Forest Soil | ADFKPPQAAVVKSDGGERCGSAGTMFPAGMVERGEREQTADEVSKRD* |
Ga0126381_1019085181 | 3300010376 | Tropical Forest Soil | ASVKSRGDERCGNAGTMIPAGTVERGERKRTAAEASKAD* |
Ga0126381_1044306711 | 3300010376 | Tropical Forest Soil | PQAAAVKSRGSERCGNVGTEIPAGKVEGGERKRTAAEASKAD* |
Ga0126381_1046123562 | 3300010376 | Tropical Forest Soil | VVKSHGDERCGNAGTMIPAGGVERGERKRTVSEVSKAD* |
Ga0136449_1025711721 | 3300010379 | Peatlands Soil | SRGGERCGNAGTKILAGKVERGERKRTVDEVSKAD* |
Ga0134124_104187591 | 3300010397 | Terrestrial Soil | GSGLKPLQAAVVKSDGSERCSQRHEDIPAGEVERGERKRTADELSKAD* |
Ga0126383_101093871 | 3300010398 | Tropical Forest Soil | KPPQAAVVKSDGGERCGNVGAMISAGKIERGERKQTASEASKSD* |
Ga0126383_136319561 | 3300010398 | Tropical Forest Soil | KSRGDERCGNAGTMIPAGTVERGERERTAAEVSKAD* |
Ga0126344_12716731 | 3300010866 | Boreal Forest Soil | SHGGERCGNVGTMIPAGTVERGERKRTAAEVSKAG* |
Ga0124844_12302292 | 3300010868 | Tropical Forest Soil | AVKSRGGERCGNVRTVILAGKVVGGERKRTAAEASKAD* |
Ga0150983_138119451 | 3300011120 | Forest Soil | PPQAAVVKSDGGERCGNVGAMIPAGKIERGERKQTASEASKSD* |
Ga0137325_11059311 | 3300011415 | Soil | QAAAVKSRGGERCGNVGTMIPAGKVERGECKRTAFEASKSD* |
Ga0137432_12187911 | 3300011439 | Soil | MKEALRGRQSGVDLKPPQAAVVKSDGGERCGKAGTKIPAGTVERGERKQTADEVSKSD* |
Ga0137389_104576472 | 3300012096 | Vadose Zone Soil | KCRGGERCGNAGTMIPAGKVERGERKQTVEEVSKAD* |
Ga0153943_10320683 | 3300012177 | Attine Ant Fungus Gardens | MALRGRQSGVDLKPPQAAVVKSDGGERCGKVGTKIPAGKVERGERKQTVDEVSKAD* |
Ga0137382_105404811 | 3300012200 | Vadose Zone Soil | ADPKAPQAAVVKSDGGERRGNVGAVISAGKIERGERKQTN* |
Ga0137365_110712541 | 3300012201 | Vadose Zone Soil | QSGVDLKPPQAAVVKSHGGERCGKARTMILAGTVERGERKRIVDEVSKAD* |
Ga0137378_103508722 | 3300012210 | Vadose Zone Soil | SYQSYGGERCGNVGAMIPAGMVERGERKRAAAEVSKAD* |
Ga0137447_10945972 | 3300012226 | Soil | FRGRLSGIGLKPPQAAVVKSDGGERCGKAGTKIPAGTVERGERKRTADEVSKSD* |
Ga0137361_100703636 | 3300012362 | Vadose Zone Soil | AAVVKSHGGERCGNVGAMIPAGMVERGERKRTVAEVSKAD* |
Ga0137361_110071191 | 3300012362 | Vadose Zone Soil | PPQAALVKSHGGERCGKVGTMIPAGTVERGERKRTVDVKRIR* |
Ga0134044_10028471 | 3300012395 | Grasslands Soil | KSHGGERCGNVGTMIPAGTVERGERKRTVDEVSKRLR* |
Ga0153928_10654141 | 3300012677 | Attine Ant Fungus Gardens | ASVKSRGCERCGNAGTMIPAGMVGRGERKQTVDEVSKAD* |
Ga0137397_102807791 | 3300012685 | Vadose Zone Soil | VADPKPPRAAAVKSRGGERRGNVGTMIPAGMVERGERKRTASEASKAD* |
Ga0137395_105040221 | 3300012917 | Vadose Zone Soil | KCRGGERCGNAGTMIPAGTVERGERKQTVDEVSKAD* |
Ga0137416_107037281 | 3300012927 | Vadose Zone Soil | LQAAAVKSRGGERCSQVWAKSPGGKVERGERKQTVDEVSKAD* |
Ga0137410_101099191 | 3300012944 | Vadose Zone Soil | PKPPQAAAVKSRGGERCGNAGTMIPAGTVERGERKRTADEVSKAD* |
Ga0126369_113106992 | 3300012971 | Tropical Forest Soil | MAKYHGGERCGNAGTMIPTGKVERGERKRTVDEVSKAD* |
Ga0164309_117887462 | 3300012984 | Soil | QVADSKPPQAAAVKSRGGERCGKVGTMIPAGMVERGERKRTAAEASKFS* |
Ga0164320_106816431 | 3300013098 | Marine Sediment | AAVAKSHGGERCGNVGTMIPAGTVERGERKRTTAEVSKAD* |
Ga0163162_120144871 | 3300013306 | Switchgrass Rhizosphere | MRNWQSGAGLKPLQAAVVKSDGGERCSQLWDHIPAGEVERGERKQTVDEVSKAD* |
Ga0120179_11267972 | 3300013763 | Permafrost | LQAAAAKSRGGERCSQVWAGSPDGKVERGERKQTVDEVSKAD* |
Ga0181530_101621521 | 3300014159 | Bog | KSNGGERCGSRDIIPAGTVERGERKQTADEVSKRD* |
Ga0075327_10251341 | 3300014272 | Natural And Restored Wetlands | GSGLKPLQAAVVKSDGGERCSQRREDIPAGEVERGERKRTAAEVSKAD* |
Ga0182024_128498391 | 3300014501 | Permafrost | QAALVKSHGGERCGNVGTMIPAGTVERGERKRTVDEVSKAG* |
Ga0182041_104948682 | 3300016294 | Soil | SGADPKPPQAAAVKSRGGERCGHAGTMILAGTVEKGERKRTADEVSKGD |
Ga0182041_121087191 | 3300016294 | Soil | RVRQSGADPKPLQAATAKSPGGERCSQVWAGSPDGKVERGERKQTVDEVSKAD |
Ga0182033_105402622 | 3300016319 | Soil | MTSFMETINLSRGRLSGTGLKPLQAAVVKSDGGERCSQRRENIPAGEVERGERKRTADELSKAD |
Ga0182035_107581672 | 3300016341 | Soil | PKPPQAAVVKSHGGERCGNAGTMIPAGKVGRGECKQTVDEVSKAD |
Ga0182034_102126151 | 3300016371 | Soil | KSHGGERCGNVGAMIPAGTVERGERKRSLGEYPIYI |
Ga0182040_101361741 | 3300016387 | Soil | AAVVKSDGGERCGNVGAMISAGKIERGERKQTASEASKSD |
Ga0182040_103807661 | 3300016387 | Soil | LRVRQSGADPKPPQAAAVKSCGGERCGNAGTMILAGTVERGERKRTADEVSKAD |
Ga0182040_119853642 | 3300016387 | Soil | ADLKPPQAAAVKSRGGERCGNVGTMIPVGTVERGERKRTAAEASKSD |
Ga0182039_101158721 | 3300016422 | Soil | GEGLKPLQAAVVKSDGGERCSQRWDHIPAGEVERGERKQTVDEVSKAD |
Ga0182039_119644351 | 3300016422 | Soil | SRGGERRGNARTMIPAGKIERGERKQTASEASKAD |
Ga0187807_12752252 | 3300017926 | Freshwater Sediment | DPKPPQAAVVKSDGGERCGNARTMILAGKVERGERKRTAEEVSKGD |
Ga0187779_110907601 | 3300017959 | Tropical Peatland | ALVKSQGSERCGKGRAMTLLGRDQGGERKRTTAEVSK |
Ga0187805_103678942 | 3300018007 | Freshwater Sediment | LRVRQSGADPKPPQAAAVKSRGSERCGNAGTVILAGKVERGERKRTADEVSKAD |
Ga0187888_12414341 | 3300018008 | Peatland | VRQSGVDLKPPQAAVVKSDGGERCGKVGTKILTGTVERGERKQTVDEVSKAD |
Ga0187874_104522111 | 3300018019 | Peatland | PKPPRAALVKSHGGERCGNVGTMIPAGTVEGGERKRTVDEVSKCD |
Ga0187861_103429961 | 3300018020 | Peatland | PQAAAIKCRGGERCGNAGTMIPAGKVERGERKQTVDEVSKAN |
Ga0187864_100987181 | 3300018022 | Peatland | SVKSRRCERCGNAETMIPAGMVERGERKQTVDEVSKAD |
Ga0187787_102119702 | 3300018029 | Tropical Peatland | VKSYGGERRGNAGTMILAGTVERGERKRTTAEASKAD |
Ga0187788_100466064 | 3300018032 | Tropical Peatland | ADPKPPRAAVVKSYGGERRGNAGAMIPAGTVERGERKRTVSEVSKAD |
Ga0187788_101025992 | 3300018032 | Tropical Peatland | DPKPPQAAAVKSRGGERCGNAGTMILAGTVERGERKQTADEVSKAD |
Ga0187867_100552671 | 3300018033 | Peatland | SGADLKPPQAAVVKSDGGERCGKVGTKILTGTVERGERKQTADEVSKRD |
Ga0187863_106985031 | 3300018034 | Peatland | KSRSCERCGNAGTMIPAGMVERGERKQTVDEVSKAD |
Ga0187875_103274143 | 3300018035 | Peatland | SGADLKPPQAAVVKSDGGERCGKVGTKILTGTVERGERKQTADEVSKAD |
Ga0187766_101199911 | 3300018058 | Tropical Peatland | ADPKPPQAAAVKSCGGERCGNAGTMILAGTVERGERKRTADEVSKAD |
Ga0187765_105681771 | 3300018060 | Tropical Peatland | PKPPQAAAVKSRGGERCGNVGTVIPAGKVEGGERKRTAAEASKAD |
Ga0187784_109661011 | 3300018062 | Tropical Peatland | LQAAVVKSDGGERCRKVGTMIPAGKVERGERKQTASEASKAD |
Ga0190268_105305432 | 3300018466 | Soil | RQSGVDLKPPQAAVVKSDGGERCGNAGTKIPAGKVERGERKQTK |
Ga0066662_122611271 | 3300018468 | Grasslands Soil | MKEALRVRQSGADLKIPQAAAVKSRGGERCGNVGTVIPAGKVEEGERKRTAAEASKAD |
Ga0184586_1277971 | 3300019194 | Soil | SDGGERCGNVGTMIPAGKIERGERKQTASEASKAD |
Ga0180114_10666311 | 3300019232 | Groundwater Sediment | PQAAVVKSDGGERCGKAGTKIPAGTVERGERKQTADEVSKSD |
Ga0180117_11159482 | 3300019248 | Groundwater Sediment | VKSDGSERCGNVGAMTPAGKVERGERKQTADEVSKTD |
Ga0181508_13272221 | 3300019256 | Peatland | EVLRVRQSGADPKPPQAAAVKSRGSERCGNAGTKILAGKVERGERKRTADEVSKAT |
Ga0137408_13966031 | 3300019789 | Vadose Zone Soil | VKSRGGERRGNAGTMIPAGMVERGERKQTASEASKAD |
Ga0179590_10993152 | 3300020140 | Vadose Zone Soil | KPLQAAVVKSDGGERCRKVGTMIPAGKVERGERKQTASEASKAD |
Ga0212168_12153533 | 3300020231 | Sediment | GFKPLQAAVVKSDGGERCRNVGTMIPAGKAQRGERKRTVDEVSKAD |
Ga0211691_101525421 | 3300020447 | Marine | KPPQAAVVKSDGGERCGNAGTMILASMVERSERKRTTAEVSKAD |
Ga0210407_104708293 | 3300020579 | Soil | KIHGGERCGKVGTMIPTGTVERDERKRTASEASKRD |
Ga0210381_102680632 | 3300021078 | Groundwater Sediment | LKPPQAAVAKRHGGERCGNARTMIPAGTVERGERKRTAAEVSKAD |
Ga0179596_106914171 | 3300021086 | Vadose Zone Soil | PPQAASVKSRGWERCGNAGTMIPAGMVERGERKQTVDEVSKAD |
Ga0210408_100400883 | 3300021178 | Soil | LVKSHGGERCGNVGTMIPAGTVERGERKRTVDEVSKAD |
Ga0210394_109834732 | 3300021420 | Soil | PKAPQAALVKSHGGERCGNVGTMIPAGMVERGERKRTVDEVSKAD |
Ga0210394_115075391 | 3300021420 | Soil | AVVKSDGGERCGNVGAMIPAGKIERGERKQTASEASKSD |
Ga0210394_118538532 | 3300021420 | Soil | AALVKSHGGERCGNVGTMIPAGTVERGERKRTVDEVSKAD |
Ga0210384_100898611 | 3300021432 | Soil | RAALVKSHGGERCGNVGTMIPAGTVERGERKRTVDEVSKAD |
Ga0210392_101271501 | 3300021475 | Soil | PKPLQAAAAKSRGCERCSQVWAGSPDGKVERGERKQTVDDVSKRD |
Ga0187846_103107201 | 3300021476 | Biofilm | SDGGERCRKVGTMIPAGKVERGERKQTASEASKAVR |
Ga0210402_104957451 | 3300021478 | Soil | MKEGPSDPKPPQAAAVKCRGGERCGNAGTRIPAGKVERGERKQTVDEMSKAD |
Ga0126371_107076992 | 3300021560 | Tropical Forest Soil | ASVKSRGDERCGNAGTMIPAGTVERGERKRTAAEASKAD |
Ga0213851_11255001 | 3300021860 | Watersheds | PQAAVVKSHGGERCGNAGTMIPAGTVERGERKRTVSEVSKAD |
Ga0224508_106940441 | 3300022413 | Sediment | ARSSGIDPKPLQAAVVKSDGGERCRNAGAKIPAGTVEGGERKRTTAEASKAD |
Ga0242655_102607831 | 3300022532 | Soil | QSGADPKPPQAAVVKSDGGERCGNAGAMVLAGKVERGERKRTAAEVSKAD |
Ga0209997_102187551 | 3300024058 | Deep Subsurface | AAVVKSHGGERCGKVGTMIPASTVERGERKRTTAEVSKAD |
Ga0209987_101594831 | 3300024060 | Deep Subsurface | VVKSDGGERCGNAGAMIPAGTVERGERKRTTAEVSKAD |
Ga0209987_104962371 | 3300024060 | Deep Subsurface | RKALRVRSSGTDPKPPQAAVVKSDGGERCGNAGAMIPAGTVERGERKRTTAEVSKAD |
Ga0228598_11178881 | 3300024227 | Rhizosphere | KSRGWERCGNAGTMIPAGMVERGERKQTVDEVSKAD |
Ga0209976_100697831 | 3300024265 | Deep Subsurface | KPPQTAVVKSDGGERCGNAGTMIPAGTVEGGERKRTTAEAS |
(restricted) Ga0233449_10039199 | 3300024302 | Seawater | DPKPLQAAVVKSDGGERCRNVGALTPAGKVKRGERKRTTAEVSKAD |
Ga0209991_104001222 | 3300024429 | Deep Subsurface | QAAVVKSDGGERCRNAGAKIPAGTVEGGERKRTTAEASKAD |
Ga0209977_100518091 | 3300024432 | Deep Subsurface | VVKSDGGERCGNAGTMIPAGTVEGGERKRTTAEAS |
Ga0209977_103482732 | 3300024432 | Deep Subsurface | AVVKSHGSERCGKVGTMIPASTVERGERKRTTAEVSKAA |
Ga0209977_103869611 | 3300024432 | Deep Subsurface | SGTDPKPPQAAVVKSDGCERCGNVGTMIPAGMVERGERKRTTAEVSKAD |
Ga0209977_105316561 | 3300024432 | Deep Subsurface | GADLKPPQAAAVKSRGGERCGNAGAMILAGTVERGERKRTAAEVSKAD |
Ga0208455_10166743 | 3300025453 | Peatland | QSGADFKPPQAAVVKSNGGERCGSRDMIPAGTVERGERKQTADEVSKRD |
Ga0208563_11116852 | 3300025501 | Peatland | SAVVKSDGGERCGKVGTKILTGTVERGERKQTADEVSKAD |
Ga0208188_10768391 | 3300025507 | Peatland | KPPQAAVVKSNGGERCGSRDMIPAGTVERGERKQTADEVSKTD |
Ga0209386_10643951 | 3300025582 | Arctic Peat Soil | KPPRAALVKNHGGERCGNVGTMIPAGTVERGERKRTVDEVSKAD |
Ga0209386_10981501 | 3300025582 | Arctic Peat Soil | VKSHGSERCGKVETMISASTVERGERKRTTAEVSKAD |
Ga0209826_12475891 | 3300025693 | Methane Seep Mesocosm | AAVVKSDGGERCRNVGAMTPSGKVKRGERKRTTAEVSKAD |
Ga0209638_11532231 | 3300025725 | Arctic Peat Soil | VRQSGADPKPLQAAAAKSRGGERCSQVWAGSPDGKVERGECKQTVDEVSKAD |
Ga0209199_100133931 | 3300025809 | Pelagic Marine | MSDGGERFRNVGALTPAGKVKRDERKRTTAEVSKAD |
Ga0209585_105139401 | 3300025891 | Arctic Peat Soil | PKPPRAALVKSHGGERCGNAGTVIPAGTVERGERKRTVDEVSKAD |
Ga0207692_108359121 | 3300025898 | Corn, Switchgrass And Miscanthus Rhizosphere | ALVKSHGGERCGNVGTMIPAGTVERGERKRTVDEVSKAD |
Ga0207680_113761111 | 3300025903 | Switchgrass Rhizosphere | VKSRGGERCGNAGTMIPAGTVERGERKRTVDEVSKAV |
Ga0207699_113046971 | 3300025906 | Corn, Switchgrass And Miscanthus Rhizosphere | SHGGERCGNVGTMIPAGTVERGERKRTVDEVSKAD |
Ga0207701_115008992 | 3300025930 | Corn, Switchgrass And Miscanthus Rhizosphere | VVKSHDRERRGNVGTMIPAGMIERGERKRTASEASKAD |
Ga0207677_115948291 | 3300026023 | Miscanthus Rhizosphere | PKPPQAAVVKSHGGERCGNAGTMIPAGTVERGERKRTVSEVSKAD |
Ga0208780_10204002 | 3300026046 | Natural And Restored Wetlands | GSGLKPLQAAVVKSDGGERCSQRREDIPAGEVERGERKRTADELSKAD |
Ga0207641_115146401 | 3300026088 | Switchgrass Rhizosphere | DLRPPQAAAVKSRGGERCGNAGTMIPAGTVERGERKRTVDEVSKAV |
Ga0207683_103653382 | 3300026121 | Miscanthus Rhizosphere | ALVKSHGGERCGNVGTKIPAGTVERGERKRTVDEVSKAD |
Ga0209848_10048901 | 3300026221 | Permafrost Soil | KPPRAALVKSHGGERRGNVGTMIPAGTVERGERKRTVDDVSKRD |
Ga0209839_100373551 | 3300026294 | Soil | LRVRQSGADPKPLQAAAAKSRGGERSSQVWAGSPDGKVERGERKQTVDEVSKAD |
Ga0209235_11782962 | 3300026296 | Grasslands Soil | RAALVKSHGGERCGNVGTMIPAGTVERGERKLTVDEVSKAD |
Ga0257180_10125241 | 3300026354 | Soil | PQAALVKSHGGERCGKVGTMIPAGTVERGERKRTVDEVSKAD |
Ga0257149_10124961 | 3300026355 | Soil | PQAASVKSRGCERCGNAGTMIPAGMVERGERKQTVDEVSKAD |
Ga0257155_10298082 | 3300026481 | Soil | VKCRGGERCGNAGTMIPAGKVERGERKQTVDEVSKAD |
Ga0257159_10630901 | 3300026494 | Soil | AASVKSRGCERCGNAGTMIPAGMVERGERKQTVDEVSKAD |
Ga0257157_10064952 | 3300026496 | Soil | SGADLKPPQAASVKSRGWERCGNAGTMIPAGMVERGERKQTVDEVSKAD |
Ga0257157_10879501 | 3300026496 | Soil | GADPKPPQAAAVKSRGGERCGNAGAMIPAGKVERGERKRTADEVSKAD |
Ga0207454_1027912 | 3300026746 | Soil | SDGGERCGKVGATIPAGKVERGERKRIVDEVSKAD |
Ga0207801_1013071 | 3300026810 | Tropical Forest Soil | PKPPRAAAVKSRGGERRGNVGTMIPAGKVERGERKQTASEASKAD |
Ga0208893_10031621 | 3300026857 | Soil | HRKLLWVKSHGGERCGNAGTMIPAGTVERGERKRTVSEVSKAD |
Ga0207746_10169502 | 3300026865 | Tropical Forest Soil | RKVLRGRQSGSGLKPLQAAVVKSDGGERCSQRRENIPAGEVERGERKRTVDELSKAD |
Ga0207858_10169832 | 3300026909 | Tropical Forest Soil | VADPKPPRAALVKSHGGERCGNVGTMIPAGTVERGERKRTVDEVSKAD |
Ga0209884_10296151 | 3300027013 | Groundwater Sand | SHGREHRGNVGTMIPAGMIERGERKRTASEASKAD |
Ga0207815_10337781 | 3300027014 | Tropical Forest Soil | QSGADLKPPQAAAVKGRGGERCGNAGTMIPAGKVERGERKQTVDEVSKAD |
Ga0209327_10329421 | 3300027307 | Forest Soil | QVTDPKPPQAAVVKSHGGERCGNAGTMIPAGTVERGERKRTVSEVSKAD |
Ga0207601_1095371 | 3300027461 | Soil | PKPPQAAVVKSDGGERCGKVGATIPAGKVERGERKRIVDEVSKAD |
Ga0208199_10328023 | 3300027497 | Peatlands Soil | PPQAASVKSRGCERCGNAGTMIPAGMVERGERKQTVDEVSKAD |
Ga0209622_10072684 | 3300027502 | Forest Soil | KSDGGERCGNVGTMIPAGMVERGERKRIAAEVSKAD |
Ga0209684_10370363 | 3300027527 | Tropical Forest Soil | AAAVKSRGGERCGNVGTAIPAGMVEGGERKRTAAEASKGD |
Ga0209419_10152131 | 3300027537 | Forest Soil | DLKPPQAASVKSRGCERCGNAGTMIPAGMVERGERKQTVDEVSKAD |
Ga0208043_10621111 | 3300027570 | Peatlands Soil | AAVKSRGGERRGNAGTMIPAGKVERGERKQTASEASKAD |
Ga0209527_10129662 | 3300027583 | Forest Soil | SGADPKPPQAAAVKSRGGERCGNAGTMILAGKVERGERKRTADEVSKAD |
Ga0209076_11851571 | 3300027643 | Vadose Zone Soil | DPKPPQAAAVKRRGGERCGNAGTMIPAGKVERGERKQTVDEVSKAD |
Ga0209117_10650371 | 3300027645 | Forest Soil | ALVKSHGGERRGNVGTMIPAGTVERGERKRTVDDVSKRD |
Ga0209388_12326551 | 3300027655 | Vadose Zone Soil | VLIPSHQQAAAVKRRGGERCGNAGTMIPAGKVERGERKQTVDEVSKAD |
Ga0209011_10459943 | 3300027678 | Forest Soil | GADPKPLQAATAKSRGGERCSQVWAGSPDGKVERGERKQTVDEVSKAD |
Ga0209446_10110443 | 3300027698 | Bog Forest Soil | LKPLQAAVVKSDGGERCSKRRDLIPSGMVWRGERKQVRRETGKE |
Ga0209178_11286411 | 3300027725 | Agricultural Soil | SGSGLKPLQAAVVKSDGGERCSQRREDIPAGEVERGERKRTAAEVSKAD |
Ga0209121_100633552 | 3300027742 | Marine | SSGIDLKPLQAAVVKSDGGERCRNAGAKIPAGTVEGGERKRTTAEASKAD |
Ga0209121_102599731 | 3300027742 | Marine | PQTAVVKSDGGERCGNAGTMIPAGKVERGERKRTTAEVS |
Ga0209448_102467521 | 3300027783 | Bog Forest Soil | PKPPRAALVKSQGGERCGNVGTMIPAGTVERGERKRTVDEVSKAD |
Ga0209040_100994522 | 3300027824 | Bog Forest Soil | QAAAVKSRGGERCGDTGAMIPAGKVERGERKRTADEVSKAD |
Ga0209693_104817542 | 3300027855 | Soil | LQAAFVKSDGGERCRKVGTMIPAGKVERGERKQTAFEASKAD |
Ga0209693_105020241 | 3300027855 | Soil | DPKPPQAALVKSHGGERCGKVGTMIPAGTVERGERKRTVDEVSKAD |
Ga0209465_100489931 | 3300027874 | Tropical Forest Soil | SDGGERCRKVGTMIPAGKVERGERKQTASEASKAD |
Ga0209068_107599061 | 3300027894 | Watersheds | PKPLQAAFVKSDGGERCRKVGTMIPAGKVERGERKQTASEASKSD |
Ga0209583_100314063 | 3300027910 | Watersheds | GADPKPLQAAAAKSRGGERCSQVWAGSPDGKVERGERKQTVDEVSKAD |
Ga0209069_105571632 | 3300027915 | Watersheds | RVRQSGADPKPPQAAAVKFRGGERCGNARTMIPAGKVERGERKQTVDEVSKAD |
Ga0209069_106242342 | 3300027915 | Watersheds | MVKSHGGERCGNAGTTIPAGKVERGERKRTADDVSKAI |
Ga0209860_10563681 | 3300027949 | Groundwater Sand | AAVKSRGGERRGNVGTMIPAGMVERGERKRTAVEASKAE |
(restricted) Ga0255057_100608442 | 3300027997 | Seawater | LRVRSSGIDPKPLQAAVVKSDGGEHCRNAGAKIPAGTVEGGERKRTTAEASKAD |
(restricted) Ga0255057_102825631 | 3300027997 | Seawater | SGADPKLPQAAVVKSHGGERCGKVGTMIPASTVERGERKRTTAEVSKAD |
Ga0265356_10177343 | 3300028017 | Rhizosphere | ASVKSRGGERRGNVGTMIPAGTVERGERKRTASEASKAD |
Ga0265306_101382302 | 3300028598 | Sediment | GIDPKPPQAAAVKSRGGERCGNAGTMIPAGTVERGERKRTTAEVSKAD |
Ga0307298_100170223 | 3300028717 | Soil | KPPQAAAAKCRGGERCGNAGTMIPAGTVERGERKRTADDVSKAD |
Ga0307282_100854942 | 3300028784 | Soil | QAAAAKCRGGERCGNAGTMIPAGTVERGERKRTADDVSKAD |
Ga0307323_102599233 | 3300028787 | Soil | AAKCRGGERCGNAGTMIPAGTVERGERKRTADDVSKAD |
Ga0302278_104724521 | 3300028866 | Bog | QSGADPKPLQAAAVKSRGGERCSQVWARSPDGEVERGERKQTVDEVSKAD |
Ga0247827_110406771 | 3300028889 | Soil | QAAVVKSRGGERCGNVGTMIPAGTVERGERKRIVDEVSKAD |
Ga0119977_1001011 | 3300029149 | Deep-Ocean Sediment | SGADPKLPQAAVVKSHGGERCGKVGTMIPASTVERGERKRTTAEASKAD |
Ga0222749_105921522 | 3300029636 | Soil | ALRGRQSGVDLKPPRAAAVKIHGGERCGKSRNKIPAGTIERGERKQTVDEVSKADY |
Ga0311368_109400121 | 3300029882 | Palsa | VADPKPPRAAAAKSRGGERRGNVGTMIPAGKVERGERKQTASEASKAD |
Ga0311330_100765794 | 3300029945 | Bog | SHGGERCGNVGTKIPAVAVERGERKRTVDEVSKAD |
Ga0316363_102625622 | 3300030659 | Peatlands Soil | PKPPQAAVIKSDGGERCGNVGAMIPAGKVERGERKQTASEASKAD |
Ga0316363_102821442 | 3300030659 | Peatlands Soil | PPQAAAVKCRGGERCGNAGTMILAGKVERGERKRTADEVSKAD |
Ga0075403_100218641 | 3300030846 | Soil | VKSHGGERCGNAGTMIPAGTVERGERKRTVSEVSKAD |
Ga0138303_14181862 | 3300030939 | Soil | VRQSGADPKSPQAAAVKSRGGERCGNARTVILAGKVERGERKRTADEVSKAD |
Ga0311366_116990602 | 3300030943 | Fen | MKEGPSGSAKPPQAAVVKSDGGERCGNVGAMISAGKIERGERKQTASEASKSD |
Ga0075399_113520471 | 3300030967 | Soil | QSGADLKPPQAAVVKSDGGERCGNVGTMIPAGKIERGERKQTVDEVSKAV |
Ga0073996_122946132 | 3300030998 | Soil | VRQSGADLKPPQAASVKSRGWERCGNAGTMIPAGMVERGERKQTVDEVSKAD |
Ga0308193_10542681 | 3300031096 | Soil | LKPPQAAAAKCRGGERCGNAGTMIPAGTVERGERKRTADDVSKAD |
Ga0307500_100300041 | 3300031198 | Soil | MAKYHGGERCGNAGTMIPVGTVEGGERKQTADEVSKAD |
Ga0307495_100124831 | 3300031199 | Soil | AAAVKSRGGERCGTPGQDSGSTVERGERKRTAAEVSKAD |
Ga0307497_101571781 | 3300031226 | Soil | AAAVKSRGGERRGNVGTMIPAGKVERGERKQTASEASKAD |
Ga0265316_106622561 | 3300031344 | Rhizosphere | VRQSGADLKPPQAASVKSRGCERCGNAGTMIPAGKVERGERKQTVDEVSKAD |
Ga0307379_114517942 | 3300031565 | Soil | VVKSDGGERCRKVETKISAGTMREGERKRTVAEASKAD |
Ga0318496_105982141 | 3300031713 | Soil | KLLRLKSRGGERCGNAGTMIPAGKVGRGECKQTVDEVSKAD |
Ga0307474_100516825 | 3300031718 | Hardwood Forest Soil | DPKPPRAALVKSHGGERCGNVGTMIPAGTVERGERKRTVEEVSKAD |
Ga0307474_101366933 | 3300031718 | Hardwood Forest Soil | AAAKSRGGERCSQVWAGSPDGKVERGERKQTVDEVSKAD |
Ga0307468_1022196881 | 3300031740 | Hardwood Forest Soil | AVKCRGGERRGNVGTMIPAGMVERGERKRTAAEASKAD |
Ga0318509_100737142 | 3300031768 | Soil | RGRQSGEGLKPLQAAVVKSDGGERCSQRWDYIPAGEVERGERKQTVDEVSKAD |
Ga0318498_104426681 | 3300031778 | Soil | DPKPPRAALVKSHGGERCGNVGAMIPAGTVERGERKRTVDEMSKAD |
Ga0302319_102338171 | 3300031788 | Bog | ALRVRQSGADLKPPQAASVKSRGCERCGNAGTMIPAGKVERGERKQTVDEVSKAD |
Ga0318550_103269362 | 3300031797 | Soil | PPQAATVKSRRGERCGKRRNVIPSGMAQRDERKQTADDVSKV |
Ga0310124_106255891 | 3300031804 | Marine | AAAVKSPGSERCGIVGTMIPASMVERGERKRTADKASKSD |
Ga0307473_105659492 | 3300031820 | Hardwood Forest Soil | PPQAAVVKSDGGERCGNVGAMISAGKIERGERKQTASEASKAD |
Ga0307473_112655741 | 3300031820 | Hardwood Forest Soil | RRSGAEPKPLQAAAVKSRGGERCSQGSDNSPAGEIEEGERKRTAAEASKAD |
Ga0318564_103950091 | 3300031831 | Soil | GADLKPPQAAAVKSRGGERCGKRRDEIPAGTVERGERKRTAAEVSKTD |
Ga0318544_104159081 | 3300031880 | Soil | SGVDLKPPQAAVVKSDGGERCGKRRDMIPAGMVERGERKRTAAEASK |
Ga0306921_120429781 | 3300031912 | Soil | MRAAALKSHGGERRGKVGTMIPADMVERGERKRTVAEA |
Ga0310913_100560794 | 3300031945 | Soil | APQAAAIKCRGGEPCGKAGTTILAGKVERGERKQTN |
Ga0310913_101176231 | 3300031945 | Soil | RQSGSGLKPLQAAVVKSDGGERCSQRRENIPAGEVERGERKRTADELSKAD |
Ga0310910_110484371 | 3300031946 | Soil | QAAAAKSRGGERCSQVWAGSPDGKVERGERKQTVDEVSKAD |
Ga0214473_104885792 | 3300031949 | Soil | SGADLKPLQAAAVKSRGGERCSQVWAEAQAGMVERGERKRTAAEASKAD |
Ga0306926_129339111 | 3300031954 | Soil | KSNGGERCGKRRDKIPAGKVERGERKRTAAEVSKA |
Ga0310911_101889332 | 3300032035 | Soil | AVKSRGGERCGNVATMIPTGKVERGERKQTVREVSKAD |
Ga0318559_102871931 | 3300032039 | Soil | KPPQAATGKSRGGERCGNAETKISAGTVEKGERKRTAAEVSKAD |
Ga0315284_109679242 | 3300032053 | Sediment | VRQSGADPKPLQAAAVKSHGGERCSQVWAGSPDGKVERGERKQTVDEVSKAD |
Ga0318570_100294703 | 3300032054 | Soil | ADPKPPQAAVVKSDGGERCGNVGAMISAGKIERGERKQTASEASKSD |
Ga0318533_101492483 | 3300032059 | Soil | SDGGERCGNVGAMISAGKIERGERKQTASEASKSD |
Ga0318514_107129062 | 3300032066 | Soil | ADPKPPRAALVKSHGGERCGNVGAMIPAGTVERGERKRTVDEVSKAD |
Ga0318525_100713213 | 3300032089 | Soil | VADPKPPQAAVVKSDGGERCGNVGAMISAGKIERGERKQTASEASKSD |
Ga0318577_103135422 | 3300032091 | Soil | PSHRKLLRLKCRGGERCGNAGTMIPAGKVGRGECKQTVDEVSKAD |
Ga0310895_103385923 | 3300032122 | Soil | AVVKSHGRERCGNVGTVIPAGMIERGERKRTASEASKAD |
Ga0311301_117892562 | 3300032160 | Peatlands Soil | SRGGERCGNAGTKILAGKVERGERKRTVDEVSKAD |
Ga0307472_1001099301 | 3300032205 | Hardwood Forest Soil | VRQSGADPKPLQAAAVKSRGGERCSQVWARSPDGKVERGERKQTVDEVSKAD |
Ga0307472_1008665761 | 3300032205 | Hardwood Forest Soil | RAALVKSHGGERCGNVGTMIPAGTAERGERKRTVDEVSKAD |
Ga0316192_107820451 | 3300032260 | Worm Burrow | IDPKPLQAAVVKSDGGERCRNAGTKIPAGTVEGGERKRTTAEASKAD |
Ga0316189_109077942 | 3300032272 | Worm Burrow | KSDGGERCRNVGAMTLIGKVKRGERKRTTSEVSKAD |
Ga0316189_110784941 | 3300032272 | Worm Burrow | QAAVVKSDGGERCRNAGTKIPAGTVEGGERKRTTAEASKAD |
Ga0316189_112246131 | 3300032272 | Worm Burrow | PQTAVVKSDGGERCGNAGAMIPAGKVERGERKRTTAEVS |
Ga0335085_112881101 | 3300032770 | Soil | KPPQAAVVKSDGGERCGNVGAMISAGKIERGERKQTASEASKSD |
Ga0335069_104846722 | 3300032893 | Soil | AAVVKSDGGERCGNVGTMIPAGKIERGERKQTVDDVSKAV |
Ga0318519_104982111 | 3300033290 | Soil | RKLLRLKCRGGERCGNAGTMIPAGKVGRGECKQTVDEVSKAD |
Ga0299912_108756512 | 3300033489 | Soil | QAAVVKSNGGERCGNAGTMIPAGTVERGERKRTADEVSKAD |
Ga0314781_085282_504_614 | 3300034660 | Soil | KSDGGERCGKVGATIPAGKVERGERKRIVDEVSKAD |
⦗Top⦘ |