NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F009040

Metagenome / Metatranscriptome Family F009040

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F009040
Family Type Metagenome / Metatranscriptome
Number of Sequences 324
Average Sequence Length 44 residues
Representative Sequence PPQAAAVKSRGGERCGNAGTMIPAGTVERGERKRTADEVSKAD
Number of Associated Samples 277
Number of Associated Scaffolds 324

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 1.54 %
% of genes near scaffold ends (potentially truncated) 94.75 %
% of genes from short scaffolds (< 2000 bps) 91.98 %
Associated GOLD sequencing projects 261
AlphaFold2 3D model prediction Yes
3D model pTM-score0.14

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (73.765 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(11.420 % of family members)
Environment Ontology (ENVO) Unclassified
(24.691 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(45.988 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Fibrous Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 0.00%    Coil/Unstructured: 100.00%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.14
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 324 Family Scaffolds
PF00078RVT_1 8.33
PF08388GIIM 7.72
PF02371Transposase_20 6.48
PF01548DEDD_Tnp_IS110 2.47
PF13458Peripla_BP_6 0.62
PF00589Phage_integrase 0.62
PF13683rve_3 0.62
PF00881Nitroreductase 0.62
PF13408Zn_ribbon_recom 0.31
PF13356Arm-DNA-bind_3 0.31
PF00106adh_short 0.31
PF02211NHase_beta 0.31
PF00364Biotin_lipoyl 0.31
PF04392ABC_sub_bind 0.31
PF13432TPR_16 0.31
PF00583Acetyltransf_1 0.31
PF12680SnoaL_2 0.31
PF05598DUF772 0.31
PF00903Glyoxalase 0.31
PF13586DDE_Tnp_1_2 0.31
PF08483Obsolete Pfam Family 0.31
PF14319Zn_Tnp_IS91 0.31
PF13701DDE_Tnp_1_4 0.31
PF01609DDE_Tnp_1 0.31
PF04986Y2_Tnp 0.31
PF13333rve_2 0.31
PF13414TPR_11 0.31
PF13546DDE_5 0.31
PF05930Phage_AlpA 0.31
PF13384HTH_23 0.31
PF13531SBP_bac_11 0.31
PF00132Hexapep 0.31
PF01380SIS 0.31
PF12833HTH_18 0.31
PF08282Hydrolase_3 0.31

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 324 Family Scaffolds
COG3547TransposaseMobilome: prophages, transposons [X] 8.95
COG0560Phosphoserine phosphataseAmino acid transport and metabolism [E] 0.31
COG0561Hydroxymethylpyrimidine pyrophosphatase and other HAD family phosphatasesCoenzyme transport and metabolism [H] 0.31
COG1877Trehalose-6-phosphate phosphataseCarbohydrate transport and metabolism [G] 0.31
COG2217Cation-transporting P-type ATPaseInorganic ion transport and metabolism [P] 0.31
COG2984ABC-type uncharacterized transport system, periplasmic componentGeneral function prediction only [R] 0.31
COG3039Transposase and inactivated derivatives, IS5 familyMobilome: prophages, transposons [X] 0.31
COG3293TransposaseMobilome: prophages, transposons [X] 0.31
COG3311DNA-binding transcriptional regulator AlpATranscription [K] 0.31
COG3385IS4 transposase InsGMobilome: prophages, transposons [X] 0.31
COG3769Mannosyl-3-phosphoglycerate phosphatase YedP/MpgP, HAD superfamilyCarbohydrate transport and metabolism [G] 0.31
COG5421TransposaseMobilome: prophages, transposons [X] 0.31
COG5433Predicted transposase YbfD/YdcC associated with H repeatsMobilome: prophages, transposons [X] 0.31
COG5659SRSO17 transposaseMobilome: prophages, transposons [X] 0.31


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms75.93 %
UnclassifiedrootN/A24.07 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2140918005|contig01774All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium mongolense → Rhizobium mongolense USDA 1844662Open in IMG/M
2170459024|GZRSKLJ01B4BDWAll Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei536Open in IMG/M
3300000189|BBAY58_c10028685Not Available862Open in IMG/M
3300000242|TDF_OR_ARG05_123mDRAFT_1074611All Organisms → cellular organisms → Bacteria → Proteobacteria656Open in IMG/M
3300000793|AF_2010_repII_A001DRAFT_10082512Not Available686Open in IMG/M
3300001083|JGI12678J13193_1005890All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium523Open in IMG/M
3300001162|JGI12714J13572_1008166All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium mongolense → Rhizobium mongolense USDA 1844553Open in IMG/M
3300001179|JGI12660J13575_100250Not Available1531Open in IMG/M
3300001394|JGI20191J14862_1053578All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium516Open in IMG/M
3300001404|JGI20181J14860_1011662All Organisms → cellular organisms → Bacteria → Proteobacteria700Open in IMG/M
3300001593|JGI12635J15846_10872404All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium514Open in IMG/M
3300001618|JGI20264J16347_10161Not Available1063Open in IMG/M
3300002921|BIH8_10012724Not Available1912Open in IMG/M
3300003224|JGI26344J46810_1018771All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales578Open in IMG/M
3300003861|Ga0031654_10215208All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium551Open in IMG/M
3300003885|Ga0063294_10586594All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49664Open in IMG/M
3300004023|Ga0055441_10172871All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium mongolense → Rhizobium mongolense USDA 1844591Open in IMG/M
3300004099|Ga0058900_1425139All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium504Open in IMG/M
3300004152|Ga0062386_101532747All Organisms → cellular organisms → Bacteria556Open in IMG/M
3300004602|Ga0068960_1272378Not Available700Open in IMG/M
3300004633|Ga0066395_10021291All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2582Open in IMG/M
3300004633|Ga0066395_10037616All Organisms → cellular organisms → Bacteria2064Open in IMG/M
3300005103|Ga0066813_1015657All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei514Open in IMG/M
3300005158|Ga0066816_1019142All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium567Open in IMG/M
3300005332|Ga0066388_104293482All Organisms → cellular organisms → Bacteria726Open in IMG/M
3300005332|Ga0066388_105713078Not Available629Open in IMG/M
3300005332|Ga0066388_106764244All Organisms → cellular organisms → Bacteria → Proteobacteria577Open in IMG/M
3300005344|Ga0070661_100234578All Organisms → cellular organisms → Bacteria → Proteobacteria1411Open in IMG/M
3300005356|Ga0070674_101831863All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium551Open in IMG/M
3300005363|Ga0008090_15704923All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1751Open in IMG/M
3300005439|Ga0070711_100065831All Organisms → cellular organisms → Bacteria → Proteobacteria2536Open in IMG/M
3300005439|Ga0070711_100714099All Organisms → cellular organisms → Bacteria845Open in IMG/M
3300005590|Ga0070727_10752880All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49546Open in IMG/M
3300005612|Ga0070723_10568537All Organisms → cellular organisms → Bacteria566Open in IMG/M
3300005614|Ga0068856_102360630All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium539Open in IMG/M
3300005713|Ga0066905_100016249All Organisms → cellular organisms → Bacteria → Proteobacteria3792Open in IMG/M
3300005719|Ga0068861_102649605All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium506Open in IMG/M
3300005764|Ga0066903_100683272All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1804Open in IMG/M
3300005764|Ga0066903_105460609Not Available670Open in IMG/M
3300005953|Ga0066383_10033242Not Available1676Open in IMG/M
3300005994|Ga0066789_10197926All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei847Open in IMG/M
3300005995|Ga0066790_10384566All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales600Open in IMG/M
3300005995|Ga0066790_10511083All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium513Open in IMG/M
3300006047|Ga0075024_100062405Not Available1574Open in IMG/M
3300006047|Ga0075024_100531546All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium621Open in IMG/M
3300006102|Ga0075015_100401631Not Available773Open in IMG/M
3300006162|Ga0075030_100187927Not Available1666Open in IMG/M
3300006163|Ga0070715_10721151Not Available598Open in IMG/M
3300006174|Ga0075014_100904654All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon528Open in IMG/M
3300006176|Ga0070765_101670146All Organisms → cellular organisms → Bacteria598Open in IMG/M
3300006235|Ga0082395_1031965All Organisms → cellular organisms → Bacteria → Proteobacteria545Open in IMG/M
3300006354|Ga0075021_10889682All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria578Open in IMG/M
3300006465|Ga0082250_10001800All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria3857Open in IMG/M
3300006606|Ga0074062_13001399All Organisms → cellular organisms → Bacteria → Proteobacteria747Open in IMG/M
3300006755|Ga0079222_10010900All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales3298Open in IMG/M
3300006792|Ga0075530_1067987All Organisms → cellular organisms → Bacteria → Proteobacteria1210Open in IMG/M
3300006844|Ga0075428_101432769Not Available725Open in IMG/M
3300006854|Ga0075425_102846165All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei532Open in IMG/M
3300006864|Ga0066797_1278970All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei583Open in IMG/M
3300006953|Ga0074063_14275835All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium904Open in IMG/M
3300007255|Ga0099791_10117849All Organisms → cellular organisms → Bacteria1229Open in IMG/M
3300007255|Ga0099791_10507693All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium586Open in IMG/M
3300007788|Ga0099795_10097791All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1147Open in IMG/M
3300008470|Ga0115371_10046380All Organisms → cellular organisms → Bacteria → Proteobacteria646Open in IMG/M
3300008470|Ga0115371_10176852All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon684Open in IMG/M
3300009036|Ga0105244_10270213Not Available790Open in IMG/M
3300009038|Ga0099829_10642395All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria882Open in IMG/M
3300009089|Ga0099828_11547862All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium584Open in IMG/M
3300009147|Ga0114129_10494264All Organisms → cellular organisms → Bacteria1599Open in IMG/M
3300009156|Ga0111538_10364593All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1829Open in IMG/M
3300009174|Ga0105241_11882205Not Available586Open in IMG/M
3300009177|Ga0105248_10152313All Organisms → cellular organisms → Bacteria2609Open in IMG/M
3300009177|Ga0105248_10262356Not Available1945Open in IMG/M
3300009488|Ga0114925_10339226Not Available1027Open in IMG/M
3300009488|Ga0114925_10998259All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales609Open in IMG/M
3300009519|Ga0116108_1198117All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium590Open in IMG/M
3300009525|Ga0116220_10245761Not Available781Open in IMG/M
3300009545|Ga0105237_11399744Not Available706Open in IMG/M
3300009553|Ga0105249_12705313All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium568Open in IMG/M
3300009641|Ga0116120_1091741All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1008Open in IMG/M
3300009641|Ga0116120_1170318All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei697Open in IMG/M
3300009643|Ga0116110_1128994All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium844Open in IMG/M
3300009645|Ga0116106_1197405All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria641Open in IMG/M
3300009646|Ga0116132_1069245Not Available1107Open in IMG/M
3300009661|Ga0105858_1096912All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium790Open in IMG/M
3300009672|Ga0116215_1058681Not Available1741Open in IMG/M
3300009683|Ga0116224_10427231All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei630Open in IMG/M
3300009817|Ga0105062_1124886All Organisms → cellular organisms → Bacteria → Proteobacteria524Open in IMG/M
3300010043|Ga0126380_10074822All Organisms → cellular organisms → Bacteria1937Open in IMG/M
3300010043|Ga0126380_10157394All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1465Open in IMG/M
3300010043|Ga0126380_12058637All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium524Open in IMG/M
3300010047|Ga0126382_12113123All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium539Open in IMG/M
3300010047|Ga0126382_12148786All Organisms → cellular organisms → Bacteria536Open in IMG/M
3300010147|Ga0126319_1557693All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei552Open in IMG/M
3300010358|Ga0126370_12372466All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium526Open in IMG/M
3300010359|Ga0126376_10106768All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2149Open in IMG/M
3300010359|Ga0126376_11291302All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium749Open in IMG/M
3300010359|Ga0126376_11709560Not Available665Open in IMG/M
3300010360|Ga0126372_10333154Not Available1352Open in IMG/M
3300010360|Ga0126372_11213819All Organisms → cellular organisms → Bacteria779Open in IMG/M
3300010360|Ga0126372_11261872All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei766Open in IMG/M
3300010361|Ga0126378_12888048All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium mongolense → Rhizobium mongolense USDA 1844548Open in IMG/M
3300010362|Ga0126377_13042225All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium541Open in IMG/M
3300010376|Ga0126381_101908518Not Available857Open in IMG/M
3300010376|Ga0126381_104430671All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium543Open in IMG/M
3300010376|Ga0126381_104612356Not Available531Open in IMG/M
3300010379|Ga0136449_102571172All Organisms → cellular organisms → Bacteria → Proteobacteria727Open in IMG/M
3300010397|Ga0134124_10418759Not Available1278Open in IMG/M
3300010398|Ga0126383_10109387All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2490Open in IMG/M
3300010398|Ga0126383_13631956All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium504Open in IMG/M
3300010866|Ga0126344_1271673All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49504Open in IMG/M
3300010868|Ga0124844_1230229All Organisms → cellular organisms → Bacteria663Open in IMG/M
3300011120|Ga0150983_13811945All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium544Open in IMG/M
3300011415|Ga0137325_1105931All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium640Open in IMG/M
3300011439|Ga0137432_1218791All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium615Open in IMG/M
3300012096|Ga0137389_10457647All Organisms → cellular organisms → Bacteria → Proteobacteria1093Open in IMG/M
3300012177|Ga0153943_1032068All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei1143Open in IMG/M
3300012200|Ga0137382_10540481Not Available830Open in IMG/M
3300012201|Ga0137365_11071254All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49582Open in IMG/M
3300012210|Ga0137378_10350872All Organisms → cellular organisms → Bacteria1371Open in IMG/M
3300012226|Ga0137447_1094597All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei590Open in IMG/M
3300012362|Ga0137361_10070363All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2962Open in IMG/M
3300012362|Ga0137361_11007119Not Available753Open in IMG/M
3300012395|Ga0134044_1002847All Organisms → cellular organisms → Bacteria → Proteobacteria644Open in IMG/M
3300012677|Ga0153928_1065414All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria699Open in IMG/M
3300012685|Ga0137397_10280779All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1241Open in IMG/M
3300012917|Ga0137395_10504022All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria872Open in IMG/M
3300012927|Ga0137416_10703728Not Available888Open in IMG/M
3300012944|Ga0137410_10109919Not Available2056Open in IMG/M
3300012971|Ga0126369_11310699All Organisms → cellular organisms → Bacteria814Open in IMG/M
3300012984|Ga0164309_11788746All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium527Open in IMG/M
3300013098|Ga0164320_10681643All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria542Open in IMG/M
3300013306|Ga0163162_12014487Not Available662Open in IMG/M
3300013763|Ga0120179_1126797All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium560Open in IMG/M
3300014159|Ga0181530_10162152All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1263Open in IMG/M
3300014272|Ga0075327_1025134Not Available1776Open in IMG/M
3300014501|Ga0182024_12849839All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium513Open in IMG/M
3300016294|Ga0182041_10494868All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1059Open in IMG/M
3300016294|Ga0182041_12108719Not Available526Open in IMG/M
3300016319|Ga0182033_10540262Not Available1006Open in IMG/M
3300016341|Ga0182035_10758167Not Available849Open in IMG/M
3300016371|Ga0182034_10212615All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1503Open in IMG/M
3300016387|Ga0182040_10136174All Organisms → cellular organisms → Bacteria → Proteobacteria1729Open in IMG/M
3300016387|Ga0182040_10380766All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium mongolense → Rhizobium mongolense USDA 18441102Open in IMG/M
3300016387|Ga0182040_11985364All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei500Open in IMG/M
3300016422|Ga0182039_10115872Not Available2010Open in IMG/M
3300016422|Ga0182039_11964435All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium538Open in IMG/M
3300017926|Ga0187807_1275225All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei555Open in IMG/M
3300017959|Ga0187779_11090760All Organisms → cellular organisms → Bacteria → Proteobacteria → Gammaproteobacteria → Enterobacterales557Open in IMG/M
3300018007|Ga0187805_10367894All Organisms → cellular organisms → Bacteria → Proteobacteria665Open in IMG/M
3300018008|Ga0187888_1241434All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales705Open in IMG/M
3300018019|Ga0187874_10452211All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium517Open in IMG/M
3300018020|Ga0187861_10342996All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Beijerinckiaceae → unclassified Beijerinckiaceae → Beijerinckiaceae bacterium633Open in IMG/M
3300018022|Ga0187864_10098718All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1523Open in IMG/M
3300018029|Ga0187787_10211970All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium689Open in IMG/M
3300018032|Ga0187788_10046606All Organisms → cellular organisms → Bacteria1462Open in IMG/M
3300018032|Ga0187788_10102599Not Available1035Open in IMG/M
3300018033|Ga0187867_10055267All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium2375Open in IMG/M
3300018034|Ga0187863_10698503All Organisms → cellular organisms → Bacteria → Proteobacteria573Open in IMG/M
3300018035|Ga0187875_10327414All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei826Open in IMG/M
3300018058|Ga0187766_10119991All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1611Open in IMG/M
3300018060|Ga0187765_10568177Not Available728Open in IMG/M
3300018062|Ga0187784_10966101All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium677Open in IMG/M
3300018466|Ga0190268_10530543All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodospirillales → Acetobacteraceae810Open in IMG/M
3300018468|Ga0066662_12261127All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Sphingobacteriia → Sphingobacteriales → Sphingobacteriaceae → Mucilaginibacter → unclassified Mucilaginibacter → Mucilaginibacter sp. Bleaf8571Open in IMG/M
3300019194|Ga0184586_127797All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium563Open in IMG/M
3300019232|Ga0180114_1066631All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium527Open in IMG/M
3300019248|Ga0180117_1115948All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon530Open in IMG/M
3300019256|Ga0181508_1327222All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium676Open in IMG/M
3300019789|Ga0137408_1396603All Organisms → cellular organisms → Bacteria1158Open in IMG/M
3300020140|Ga0179590_1099315All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium783Open in IMG/M
3300020231|Ga0212168_1215353Not Available2386Open in IMG/M
3300020447|Ga0211691_10152542Not Available875Open in IMG/M
3300020579|Ga0210407_10470829All Organisms → cellular organisms → Bacteria982Open in IMG/M
3300021078|Ga0210381_10268063All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium610Open in IMG/M
3300021086|Ga0179596_10691417All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium mongolense → Rhizobium mongolense USDA 1844516Open in IMG/M
3300021178|Ga0210408_10040088All Organisms → cellular organisms → Bacteria → Proteobacteria3679Open in IMG/M
3300021420|Ga0210394_10983473All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium731Open in IMG/M
3300021420|Ga0210394_11507539All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium568Open in IMG/M
3300021420|Ga0210394_11853853All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium501Open in IMG/M
3300021432|Ga0210384_10089861All Organisms → cellular organisms → Bacteria → Proteobacteria2758Open in IMG/M
3300021475|Ga0210392_10127150Not Available1713Open in IMG/M
3300021476|Ga0187846_10310720All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium651Open in IMG/M
3300021478|Ga0210402_10495745All Organisms → cellular organisms → Bacteria1134Open in IMG/M
3300021560|Ga0126371_10707699Not Available1155Open in IMG/M
3300021860|Ga0213851_1125500All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei1386Open in IMG/M
3300022413|Ga0224508_10694044All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria624Open in IMG/M
3300022532|Ga0242655_10260783All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium552Open in IMG/M
3300024058|Ga0209997_10218755All Organisms → cellular organisms → Bacteria → Proteobacteria931Open in IMG/M
3300024060|Ga0209987_10159483Not Available1294Open in IMG/M
3300024060|Ga0209987_10496237All Organisms → cellular organisms → Bacteria654Open in IMG/M
3300024227|Ga0228598_1117888All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium mongolense → Rhizobium mongolense USDA 1844538Open in IMG/M
3300024265|Ga0209976_10069783All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1841Open in IMG/M
(restricted) 3300024302|Ga0233449_1003919All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Rhodobacterales → Roseobacteraceae → Litoreibacter → Litoreibacter halocynthiae10497Open in IMG/M
3300024429|Ga0209991_10400122Not Available642Open in IMG/M
3300024432|Ga0209977_10051809All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1997Open in IMG/M
3300024432|Ga0209977_10348273All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49707Open in IMG/M
3300024432|Ga0209977_10386961All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49664Open in IMG/M
3300024432|Ga0209977_10531656All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium544Open in IMG/M
3300025453|Ga0208455_1016674All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1794Open in IMG/M
3300025501|Ga0208563_1111685All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei520Open in IMG/M
3300025507|Ga0208188_1076839All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium784Open in IMG/M
3300025582|Ga0209386_1064395All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium651Open in IMG/M
3300025582|Ga0209386_1098150All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49521Open in IMG/M
3300025693|Ga0209826_1247589All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon503Open in IMG/M
3300025725|Ga0209638_1153223Not Available740Open in IMG/M
3300025809|Ga0209199_1001339All Organisms → cellular organisms → Bacteria29945Open in IMG/M
3300025891|Ga0209585_10513940All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium500Open in IMG/M
3300025898|Ga0207692_10835912All Organisms → cellular organisms → Bacteria603Open in IMG/M
3300025903|Ga0207680_11376111All Organisms → cellular organisms → Bacteria → Proteobacteria501Open in IMG/M
3300025906|Ga0207699_11304697All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium537Open in IMG/M
3300025930|Ga0207701_11500899All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49546Open in IMG/M
3300026023|Ga0207677_11594829All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium604Open in IMG/M
3300026046|Ga0208780_1020400All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria608Open in IMG/M
3300026088|Ga0207641_11514640All Organisms → cellular organisms → Bacteria → Proteobacteria672Open in IMG/M
3300026121|Ga0207683_10365338All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1325Open in IMG/M
3300026221|Ga0209848_1004890All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2763Open in IMG/M
3300026294|Ga0209839_10037355Not Available1811Open in IMG/M
3300026296|Ga0209235_1178296All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium785Open in IMG/M
3300026354|Ga0257180_1012524All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1034Open in IMG/M
3300026355|Ga0257149_1012496Not Available1113Open in IMG/M
3300026481|Ga0257155_1029808Not Available810Open in IMG/M
3300026494|Ga0257159_1063090All Organisms → cellular organisms → Bacteria → Proteobacteria634Open in IMG/M
3300026496|Ga0257157_1006495Not Available1806Open in IMG/M
3300026496|Ga0257157_1087950All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium539Open in IMG/M
3300026746|Ga0207454_102791All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei602Open in IMG/M
3300026810|Ga0207801_101307Not Available1842Open in IMG/M
3300026857|Ga0208893_1003162All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium593Open in IMG/M
3300026865|Ga0207746_1016950All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium614Open in IMG/M
3300026909|Ga0207858_1016983All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium704Open in IMG/M
3300027013|Ga0209884_1029615All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium574Open in IMG/M
3300027014|Ga0207815_1033778Not Available621Open in IMG/M
3300027307|Ga0209327_1032942All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium725Open in IMG/M
3300027461|Ga0207601_109537All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei621Open in IMG/M
3300027497|Ga0208199_1032802All Organisms → cellular organisms → Bacteria1134Open in IMG/M
3300027502|Ga0209622_1007268All Organisms → cellular organisms → Bacteria1815Open in IMG/M
3300027527|Ga0209684_1037036Not Available747Open in IMG/M
3300027537|Ga0209419_1015213Not Available1360Open in IMG/M
3300027570|Ga0208043_1062111All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1067Open in IMG/M
3300027583|Ga0209527_1012966Not Available1791Open in IMG/M
3300027643|Ga0209076_1185157All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium575Open in IMG/M
3300027645|Ga0209117_1065037All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Fungi incertae sedis → Mucoromycota → Glomeromycotina → Glomeromycetes → Glomerales → Glomeraceae → Glomus → Glomus cerebriforme1049Open in IMG/M
3300027655|Ga0209388_1232655All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium504Open in IMG/M
3300027678|Ga0209011_1045994Not Available1345Open in IMG/M
3300027698|Ga0209446_1011044All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2216Open in IMG/M
3300027725|Ga0209178_1128641Not Available863Open in IMG/M
3300027742|Ga0209121_10063355All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium mongolense → Rhizobium mongolense USDA 18441787Open in IMG/M
3300027742|Ga0209121_10259973All Organisms → cellular organisms → Bacteria → Proteobacteria589Open in IMG/M
3300027783|Ga0209448_10246752All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium589Open in IMG/M
3300027824|Ga0209040_10099452Not Available1649Open in IMG/M
3300027855|Ga0209693_10481754All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49595Open in IMG/M
3300027855|Ga0209693_10502024All Organisms → cellular organisms → Bacteria580Open in IMG/M
3300027874|Ga0209465_10048993All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium2019Open in IMG/M
3300027894|Ga0209068_10759906All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium570Open in IMG/M
3300027910|Ga0209583_10031406All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1765Open in IMG/M
3300027915|Ga0209069_10557163All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiaceae → Ralstonia → Ralstonia solanacearum654Open in IMG/M
3300027915|Ga0209069_10624234All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Betaproteobacteria incertae sedis → Candidatus Accumulibacter → unclassified Candidatus Accumulibacter → Candidatus Accumulibacter sp.624Open in IMG/M
3300027949|Ga0209860_1056368All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium521Open in IMG/M
(restricted) 3300027997|Ga0255057_10060844All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1816Open in IMG/M
(restricted) 3300027997|Ga0255057_10282563All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylosinus → unclassified Methylosinus → Methylosinus sp. C49804Open in IMG/M
3300028017|Ga0265356_1017734All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium770Open in IMG/M
3300028598|Ga0265306_10138230All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1273Open in IMG/M
3300028717|Ga0307298_10017022All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1861Open in IMG/M
3300028784|Ga0307282_10085494Not Available1449Open in IMG/M
3300028787|Ga0307323_10259923All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales625Open in IMG/M
3300028866|Ga0302278_10472452All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium538Open in IMG/M
3300028889|Ga0247827_11040677All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei559Open in IMG/M
3300029149|Ga0119977_100101Not Available1327Open in IMG/M
3300029636|Ga0222749_10592152All Organisms → cellular organisms → Bacteria605Open in IMG/M
3300029882|Ga0311368_10940012All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium576Open in IMG/M
3300029945|Ga0311330_10076579All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales3459Open in IMG/M
3300030659|Ga0316363_10262562Not Available699Open in IMG/M
3300030659|Ga0316363_10282144All Organisms → cellular organisms → Bacteria → Proteobacteria668Open in IMG/M
3300030846|Ga0075403_10021864All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium537Open in IMG/M
3300030939|Ga0138303_1418186Not Available536Open in IMG/M
3300030943|Ga0311366_11699060All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium540Open in IMG/M
3300030967|Ga0075399_11352047All Organisms → cellular organisms → Bacteria → Proteobacteria636Open in IMG/M
3300030998|Ga0073996_12294613Not Available1648Open in IMG/M
3300031096|Ga0308193_1054268Not Available609Open in IMG/M
3300031198|Ga0307500_10030004All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1226Open in IMG/M
3300031199|Ga0307495_10012483All Organisms → cellular organisms → Bacteria → Proteobacteria1283Open in IMG/M
3300031226|Ga0307497_10157178Not Available949Open in IMG/M
3300031344|Ga0265316_10662256Not Available737Open in IMG/M
3300031565|Ga0307379_11451794All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon550Open in IMG/M
3300031713|Ga0318496_10598214All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium609Open in IMG/M
3300031718|Ga0307474_10051682All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae3034Open in IMG/M
3300031718|Ga0307474_10136693Not Available1844Open in IMG/M
3300031740|Ga0307468_102219688All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium531Open in IMG/M
3300031768|Ga0318509_10073714Not Available1796Open in IMG/M
3300031778|Ga0318498_10442668All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium575Open in IMG/M
3300031788|Ga0302319_10233817All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Methylocystaceae → Methylocystis2258Open in IMG/M
3300031797|Ga0318550_10326936All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium mongolense → Rhizobium mongolense USDA 1844744Open in IMG/M
3300031804|Ga0310124_10625589Not Available618Open in IMG/M
3300031820|Ga0307473_10565949Not Available779Open in IMG/M
3300031820|Ga0307473_11265574Not Available551Open in IMG/M
3300031831|Ga0318564_10395009All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei605Open in IMG/M
3300031880|Ga0318544_10415908All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium523Open in IMG/M
3300031912|Ga0306921_12042978Not Available609Open in IMG/M
3300031945|Ga0310913_10056079All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2585Open in IMG/M
3300031945|Ga0310913_10117623Not Available1812Open in IMG/M
3300031946|Ga0310910_11048437Not Available636Open in IMG/M
3300031949|Ga0214473_10488579All Organisms → cellular organisms → Bacteria → Proteobacteria1376Open in IMG/M
3300031954|Ga0306926_12933911All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei511Open in IMG/M
3300032035|Ga0310911_10188933All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1169Open in IMG/M
3300032039|Ga0318559_10287193All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei763Open in IMG/M
3300032053|Ga0315284_10967924Not Available963Open in IMG/M
3300032054|Ga0318570_10029470All Organisms → cellular organisms → Bacteria → Proteobacteria2164Open in IMG/M
3300032059|Ga0318533_10149248Not Available1653Open in IMG/M
3300032066|Ga0318514_10712906All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium533Open in IMG/M
3300032089|Ga0318525_10071321All Organisms → cellular organisms → Bacteria1745Open in IMG/M
3300032091|Ga0318577_10313542All Organisms → cellular organisms → Bacteria → Proteobacteria750Open in IMG/M
3300032122|Ga0310895_10338592All Organisms → cellular organisms → Bacteria722Open in IMG/M
3300032160|Ga0311301_11789256All Organisms → cellular organisms → Bacteria → Proteobacteria732Open in IMG/M
3300032205|Ga0307472_100109930Not Available1920Open in IMG/M
3300032205|Ga0307472_100866576All Organisms → cellular organisms → Bacteria832Open in IMG/M
3300032260|Ga0316192_10782045All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium mongolense → Rhizobium mongolense USDA 1844642Open in IMG/M
3300032272|Ga0316189_10907794All Organisms → cellular organisms → Archaea → TACK group → Candidatus Bathyarchaeota → unclassified Candidatus Bathyarchaeota → Candidatus Bathyarchaeota archaeon668Open in IMG/M
3300032272|Ga0316189_11078494All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Rhizobiaceae → Rhizobium/Agrobacterium group → Rhizobium → Rhizobium mongolense → Rhizobium mongolense USDA 1844607Open in IMG/M
3300032272|Ga0316189_11224613All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales566Open in IMG/M
3300032770|Ga0335085_11288110All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium772Open in IMG/M
3300032893|Ga0335069_10484672All Organisms → cellular organisms → Bacteria → Proteobacteria1437Open in IMG/M
3300033290|Ga0318519_10498211All Organisms → cellular organisms → Bacteria → Proteobacteria733Open in IMG/M
3300033489|Ga0299912_10875651Not Available680Open in IMG/M
3300034660|Ga0314781_085282All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium erythrophlei616Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil11.42%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Tropical Forest Soil6.48%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil6.17%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil4.63%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil4.01%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil3.70%
Deep SubsurfaceEnvironmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface3.40%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds3.09%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil3.09%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil3.09%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland2.78%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland2.47%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil2.16%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil2.16%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland2.16%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil1.54%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil1.54%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Soil1.54%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.54%
Worm BurrowEnvironmental → Aquatic → Marine → Coastal → Sediment → Worm Burrow1.23%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.23%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.93%
SoilEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Soil0.93%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.93%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil0.93%
Groundwater SandEnvironmental → Terrestrial → Soil → Sand → Unclassified → Groundwater Sand0.93%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog0.93%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.93%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Freshwater Sediment0.62%
SedimentEnvironmental → Aquatic → Marine → Oceanic → Sediment → Sediment0.62%
Marine SedimentEnvironmental → Aquatic → Marine → Coastal → Sediment → Marine Sediment0.62%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine0.62%
MarineEnvironmental → Aquatic → Marine → Oil Seeps → Unclassified → Marine0.62%
SeawaterEnvironmental → Aquatic → Marine → Gulf → Unclassified → Seawater0.62%
SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Sediment0.62%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil0.62%
Agricultural SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Agricultural Soil0.62%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.62%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Uranium Contaminated → Soil0.62%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.62%
Natural And Restored WetlandsEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Natural And Restored Wetlands0.62%
Permafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil0.62%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.62%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.62%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere0.62%
Attine Ant Fungus GardensHost-Associated → Fungi → Mycelium → Unclassified → Unclassified → Attine Ant Fungus Gardens0.62%
WatershedsEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds0.31%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment0.31%
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment0.31%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog0.31%
SoilEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Soil0.31%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine0.31%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine0.31%
Deep-Ocean SedimentEnvironmental → Aquatic → Marine → Oceanic → Sediment → Deep-Ocean Sediment0.31%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater0.31%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Marine0.31%
Natural And Restored WetlandsEnvironmental → Aquatic → Marine → Wetlands → Unclassified → Natural And Restored Wetlands0.31%
Methane Seep MesocosmEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Methane Seep Mesocosm0.31%
Pelagic MarineEnvironmental → Aquatic → Marine → Pelagic → Unclassified → Pelagic Marine0.31%
Coastal Water And SedimentEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Coastal Water And Sediment0.31%
Hydrothermal VentsEnvironmental → Aquatic → Marine → Hydrothermal Vents → Black Smokers → Hydrothermal Vents0.31%
Marine SedimentEnvironmental → Aquatic → Marine → Hydrothermal Vents → Sediment → Marine Sediment0.31%
SedimentEnvironmental → Aquatic → Marine → Sediment → Unclassified → Sediment0.31%
SedimentEnvironmental → Aquatic → Marine → Subtidal Zone → Sediment → Sediment0.31%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.31%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grasslands Soil0.31%
Grass SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Grass Soil0.31%
PermafrostEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Permafrost0.31%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Corn, Switchgrass And Miscanthus Rhizosphere0.31%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.31%
PermafrostEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost0.31%
SoilEnvironmental → Terrestrial → Soil → Clay → Unclassified → Soil0.31%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen0.31%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa0.31%
BiofilmEnvironmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm0.31%
Delisea Pulchra's SurfaceHost-Associated → Algae → Red Algae → Ectosymbionts → Unclassified → Delisea Pulchra's Surface0.31%
Delisea PulchraHost-Associated → Algae → Red Algae → Unclassified → Unclassified → Delisea Pulchra0.31%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere0.31%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.31%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.31%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere0.31%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.31%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.31%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.31%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.31%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.31%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil0.31%
Tropical Rainforest SoilEnvironmental → Terrestrial → Soil → Unclassified → Tropical Rainforest → Tropical Rainforest Soil0.31%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
2140918005Marine sediment microbial communities from Arctic Ocean, off the coast from Alaska - sample from high methane PC12-225-485cmEnvironmentalOpen in IMG/M
2170459024Grass soil microbial communities from Rothamsted Park, UK - FD1 (NaCl 300g/L 5ml)EnvironmentalOpen in IMG/M
3300000189Delisea pulchra's surface microbial communities from Botany Bay, Sydney, Australia - BBAY58_SOAP_k21_Abyss_k53_GAAHost-AssociatedOpen in IMG/M
3300000242Marine microbial communities from chronically polluted sediments in Tierra del Fuego: Site OR sample ARG 05_12.3mEnvironmentalOpen in IMG/M
3300000793Forest soil microbial communities from Amazon forest - 2010 replicate II A001EnvironmentalOpen in IMG/M
3300001083Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M1EnvironmentalOpen in IMG/M
3300001162Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M2EnvironmentalOpen in IMG/M
3300001179Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M3EnvironmentalOpen in IMG/M
3300001394Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210 deep-092012EnvironmentalOpen in IMG/M
3300001404Arctic peat soil from Barrow, Alaska - NGEE Surface sample 415-2 deep-072012EnvironmentalOpen in IMG/M
3300001593Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2EnvironmentalOpen in IMG/M
3300001618Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF030EnvironmentalOpen in IMG/M
3300002921Delisea pulchra microbial communities from Sydney, Australia, affected by bleaching disease - 2012_BI_H8Host-AssociatedOpen in IMG/M
3300003224Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM3EnvironmentalOpen in IMG/M
3300003861Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - CRP12 CREnvironmentalOpen in IMG/M
3300003885Black smoker hydrothermal vent sediment microbial communities from the Guaymas Basin, Mid-Atlantic Ridge, South Atlantic Ocean - Sample 1EnvironmentalOpen in IMG/M
3300004023Wetland microbial communities from San Francisco Bay, California, USA, that impact long-term carbon sequestration - China_Bullhead_CordA_D2EnvironmentalOpen in IMG/M
3300004099Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaT HF236 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004152Coassembly of ECP12_OM1, ECP12_OM2, ECP12_OM3EnvironmentalOpen in IMG/M
3300004602Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 52 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004633Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBioEnvironmentalOpen in IMG/M
3300005103Soil and rhizosphere microbial communities from Laval, Canada - mgLAAEnvironmentalOpen in IMG/M
3300005158Soil and rhizosphere microbial communities from Laval, Canada - mgHAAEnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005344Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaGHost-AssociatedOpen in IMG/M
3300005356Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaGHost-AssociatedOpen in IMG/M
3300005363Tropical rainforest soil microbial communities from the Amazon Forest, Brazil, analyzing deforestation - Metatranscriptome F II A100 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300005439Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaGEnvironmentalOpen in IMG/M
3300005590Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd47.2EnvironmentalOpen in IMG/M
3300005612Marine sediment microbial communities from the Atlantic coast under amendment with organic carbon and nitrate - tdAd00.2EnvironmentalOpen in IMG/M
3300005614Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2Host-AssociatedOpen in IMG/M
3300005713Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 36 (version 2)EnvironmentalOpen in IMG/M
3300005719Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2Host-AssociatedOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300005953Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S23_td_Bottom_ad_3770_LV_AEnvironmentalOpen in IMG/M
3300005994Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-049EnvironmentalOpen in IMG/M
3300005995Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050EnvironmentalOpen in IMG/M
3300006047Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013EnvironmentalOpen in IMG/M
3300006102Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013EnvironmentalOpen in IMG/M
3300006162Freshwater sediment microbial communities from Pennsylvania, USA - Little Laurel Run_MetaG_LLR_2012EnvironmentalOpen in IMG/M
3300006163Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaGEnvironmentalOpen in IMG/M
3300006174Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2014EnvironmentalOpen in IMG/M
3300006176Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5EnvironmentalOpen in IMG/M
3300006235Marine sediment microbial communities, 33.9 km from oil contamination, ambient, Gulf of Mexico ? BC463EnvironmentalOpen in IMG/M
3300006354Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012EnvironmentalOpen in IMG/M
3300006465Deep-sea sediment bacterial and archaeal communities from Fram Strait - Hausgarten IXEnvironmentalOpen in IMG/M
3300006606Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006755Agricultural soil microbial communities from Georgia to study Nitrogen management - GA PlitterEnvironmentalOpen in IMG/M
3300006792Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE PermafrostL1-DEnvironmentalOpen in IMG/M
3300006844Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2Host-AssociatedOpen in IMG/M
3300006854Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD4Host-AssociatedOpen in IMG/M
3300006864Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Permafrost soil replicate 3 DNA2013-193EnvironmentalOpen in IMG/M
3300006953Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMB (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300007255Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1EnvironmentalOpen in IMG/M
3300007788Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2EnvironmentalOpen in IMG/M
3300008470Sediment core microbial communities from Adelie Basin, Antarctica. Combined Assembly of Gp0136540, Gp0136562, Gp0136563EnvironmentalOpen in IMG/M
3300009036Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaGHost-AssociatedOpen in IMG/M
3300009038Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H2.8 metaGEnvironmentalOpen in IMG/M
3300009089Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - CZOApr15con2H1.8 metaGEnvironmentalOpen in IMG/M
3300009147Populus root and rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2)Host-AssociatedOpen in IMG/M
3300009156Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. TD hybrid SBSTD1 (version 2)Host-AssociatedOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009177Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaGHost-AssociatedOpen in IMG/M
3300009488Deep subsurface microbial communities from Indian Ocean to uncover new lineages of life (NeLLi) - Sumatra_00607 metaGEnvironmentalOpen in IMG/M
3300009519Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_150EnvironmentalOpen in IMG/M
3300009525Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaGEnvironmentalOpen in IMG/M
3300009545Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaGHost-AssociatedOpen in IMG/M
3300009553Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaGHost-AssociatedOpen in IMG/M
3300009641Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_11_150EnvironmentalOpen in IMG/M
3300009643Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_40EnvironmentalOpen in IMG/M
3300009645Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_6_40EnvironmentalOpen in IMG/M
3300009646Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_150EnvironmentalOpen in IMG/M
3300009661Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-062EnvironmentalOpen in IMG/M
3300009672Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_2_FS metaGEnvironmentalOpen in IMG/M
3300009683Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_b_LC metaGEnvironmentalOpen in IMG/M
3300009817Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S3_10_20EnvironmentalOpen in IMG/M
3300010043Tropical forest soil microbial communities from Panama - MetaG Plot_26EnvironmentalOpen in IMG/M
3300010047Tropical forest soil microbial communities from Panama - MetaG Plot_30EnvironmentalOpen in IMG/M
3300010147Soil microbial communities from California, USA to study soil gas exchange rates - BB-CA-RED metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010358Tropical forest soil microbial communities from Panama - MetaG Plot_3EnvironmentalOpen in IMG/M
3300010359Tropical forest soil microbial communities from Panama - MetaG Plot_15EnvironmentalOpen in IMG/M
3300010360Tropical forest soil microbial communities from Panama - MetaG Plot_6EnvironmentalOpen in IMG/M
3300010361Tropical forest soil microbial communities from Panama - MetaG Plot_23EnvironmentalOpen in IMG/M
3300010362Tropical forest soil microbial communities from Panama - MetaG Plot_22EnvironmentalOpen in IMG/M
3300010376Tropical forest soil microbial communities from Panama - MetaG Plot_28EnvironmentalOpen in IMG/M
3300010379Sb_50d combined assemblyEnvironmentalOpen in IMG/M
3300010397Terrestrial soil microbial communities without Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-0-4EnvironmentalOpen in IMG/M
3300010398Tropical forest soil microbial communities from Panama - MetaG Plot_35EnvironmentalOpen in IMG/M
3300010866Boreal forest soil eukaryotic communities from Alaska, USA - C1-3 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300010868Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (PacBio error correction)EnvironmentalOpen in IMG/M
3300011120Combined assembly of Microbial Forest Soil metaTEnvironmentalOpen in IMG/M
3300011415Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT469_2EnvironmentalOpen in IMG/M
3300011439Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMZT820_2EnvironmentalOpen in IMG/M
3300012096Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - 15con2h1.4B metaGEnvironmentalOpen in IMG/M
3300012177Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ027 MetaGHost-AssociatedOpen in IMG/M
3300012200Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_20_16 metaGEnvironmentalOpen in IMG/M
3300012201Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012210Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_60_16 metaGEnvironmentalOpen in IMG/M
3300012226Soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River MetaG ERMGT400_2EnvironmentalOpen in IMG/M
3300012362Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_80_16 metaGEnvironmentalOpen in IMG/M
3300012395Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - 15_R_Glu_40cm_2_8_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012677Attine ant fungus gardens microbial communities from New Jersey, USA - TSNJ012 MetaGHost-AssociatedOpen in IMG/M
3300012685Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czorhiz1.16 metaGEnvironmentalOpen in IMG/M
3300012917Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - czobulk2.16 metaGEnvironmentalOpen in IMG/M
3300012927Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug3_1_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012944Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012971Tropical forest soil microbial communities from Panama - MetaG Plot_1EnvironmentalOpen in IMG/M
3300012984Soil microbial communities amended with fresh organic matter from upstate New York, USA - Whitman soil sample_247_MGEnvironmentalOpen in IMG/M
3300013098Subseafloor sediment microbial communities from Guaymas Basin, Gulf of California, Mexico - Guay11, Core 4567-28, 0-3 cmEnvironmentalOpen in IMG/M
3300013306Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaGHost-AssociatedOpen in IMG/M
3300013763Permafrost microbial communities from Nunavut, Canada - A15_65cm_0MEnvironmentalOpen in IMG/M
3300014159Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_60_metaGEnvironmentalOpen in IMG/M
3300014272Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberrySE_CattailB_D1EnvironmentalOpen in IMG/M
3300014501Permafrost microbial communities from Stordalen Mire, Sweden - P3-2 metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300016387Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176EnvironmentalOpen in IMG/M
3300016422Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statanox.12C.anox.44.000.111EnvironmentalOpen in IMG/M
3300017926Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - ASW_2EnvironmentalOpen in IMG/M
3300017959Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_10_MGEnvironmentalOpen in IMG/M
3300018007Wetland sediment microbial communities from Neuse River Estuary, North Carolina, USA - Control_5EnvironmentalOpen in IMG/M
3300018008Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_7_40EnvironmentalOpen in IMG/M
3300018019Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_16_150EnvironmentalOpen in IMG/M
3300018020Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_10_100EnvironmentalOpen in IMG/M
3300018022Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_40EnvironmentalOpen in IMG/M
3300018029Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP06_20_MGEnvironmentalOpen in IMG/M
3300018032Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_BV01_MP10_20_MGEnvironmentalOpen in IMG/M
3300018033Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_13_10EnvironmentalOpen in IMG/M
3300018034Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_11_10EnvironmentalOpen in IMG/M
3300018035Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_17_10EnvironmentalOpen in IMG/M
3300018058Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_20_MGEnvironmentalOpen in IMG/M
3300018060Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MGEnvironmentalOpen in IMG/M
3300018062Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_SJ02_MP15_20_MGEnvironmentalOpen in IMG/M
3300018466Populus adjacent soil microbial communities from riparian zone of Blue River, Arizona, USA - 249 TEnvironmentalOpen in IMG/M
3300018468Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_111EnvironmentalOpen in IMG/M
3300019194Soil microbial communities from Bohemian Forest, Czech Republic ? CSE1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019232Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT530_16_1Ra (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019248Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT660_2_16_1Ra (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019256Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_10_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019789Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300020140Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300020231Deep-sea sediment microbial communities from the Mariana Trench, Pacific Ocean - CR04EnvironmentalOpen in IMG/M
3300020447Marine microbial communities from Tara Oceans - TARA_B100000745 (ERX556090-ERR599159)EnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300021078Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM1_5_coex redoEnvironmentalOpen in IMG/M
3300021086Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZODoug1_1_08_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300021178Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-MEnvironmentalOpen in IMG/M
3300021420Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-12-MEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021475Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-OEnvironmentalOpen in IMG/M
3300021476Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2)EnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021560Tropical forest soil microbial communities from Panama - MetaG Plot_4EnvironmentalOpen in IMG/M
3300021860Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2014 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022413Sediment microbial communities from San Francisco Bay, California, United States - SF_Jan12_sed_USGS_21EnvironmentalOpen in IMG/M
3300022532Metatranscriptome of forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Native-BW-C-4-M (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300024058Deep subsurface microbial communities from Mariana Trench to uncover new lineages of life (NeLLi) - CR04 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300024060Deep subsurface microbial communities from Kermadec Trench to uncover new lineages of life (NeLLi) - N074 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300024227Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4Host-AssociatedOpen in IMG/M
3300024265Deep subsurface microbial communities from Indian Ocean to uncover new lineages of life (NeLLi) - Sumatra_00157 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300024302 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_124_October2016_200_MGEnvironmentalOpen in IMG/M
3300024429Deep subsurface microbial communities from South Pacific Ocean to uncover new lineages of life (NeLLi) - Chile_00310 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300024432Deep subsurface microbial communities from Indian Ocean to uncover new lineages of life (NeLLi) - Sumatra_00607 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025453Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_4_40 (SPAdes)EnvironmentalOpen in IMG/M
3300025501Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_17_150 (SPAdes)EnvironmentalOpen in IMG/M
3300025507Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_8_40 (SPAdes)EnvironmentalOpen in IMG/M
3300025582Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost154B-two (SPAdes)EnvironmentalOpen in IMG/M
3300025693Methane-oxidizing microbial communities from mesocosms in the Gulf of Mexico - GOM15C Gulf of Mexico (SPAdes)EnvironmentalOpen in IMG/M
3300025725Arctic peat soil from Barrow, Alaska - Barrow Graham LP Ref core NGADG0002-211 (SPAdes)EnvironmentalOpen in IMG/M
3300025809Pelagic marine microbial communities from North Sea - COGITO_mtgs_110523 (SPAdes)EnvironmentalOpen in IMG/M
3300025891Arctic peat soil microbial communities from the Barrow Environmental Observatory site, Barrow, Alaska, USA - NGEE Permafrost154B-one (SPAdes)EnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025903Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025906Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025930Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes)EnvironmentalOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026046Natural and restored wetland microbial communities from the San Francisco Bay, California, USA, that impact long-term carbon sequestration - MayberryNW_TuleC_D1 (SPAdes)EnvironmentalOpen in IMG/M
3300026088Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026121Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026221Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-062 (SPAdes)EnvironmentalOpen in IMG/M
3300026294Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil replicate 3 DNA2013-050 (SPAdes)EnvironmentalOpen in IMG/M
3300026296Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample 09_25_2013_1_20cm (SPAdes)EnvironmentalOpen in IMG/M
3300026354Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NR-04-BEnvironmentalOpen in IMG/M
3300026355Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-02-AEnvironmentalOpen in IMG/M
3300026481Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-19-AEnvironmentalOpen in IMG/M
3300026494Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-07-AEnvironmentalOpen in IMG/M
3300026496Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NI-69-AEnvironmentalOpen in IMG/M
3300026746Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-G06K2-12 (SPAdes)EnvironmentalOpen in IMG/M
3300026810Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 16 (SPAdes)EnvironmentalOpen in IMG/M
3300026857Soil and rhizosphere microbial communities from Laval, Canada - mgLMB (SPAdes)EnvironmentalOpen in IMG/M
3300026865Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 75 (SPAdes)EnvironmentalOpen in IMG/M
3300026909Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 23 (SPAdes)EnvironmentalOpen in IMG/M
3300027013Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW N3_30_40 (SPAdes)EnvironmentalOpen in IMG/M
3300027014Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 4 (SPAdes)EnvironmentalOpen in IMG/M
3300027307Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300027461Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, USA - Nitrogen cycling UWRJ-ROWE15-E (SPAdes)EnvironmentalOpen in IMG/M
3300027497Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_1_NS metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027502Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027527Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 6 MoBio (SPAdes)EnvironmentalOpen in IMG/M
3300027537Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM1H0_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027570Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_9_AC metaG (SPAdes)EnvironmentalOpen in IMG/M
3300027583Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027643Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes)EnvironmentalOpen in IMG/M
3300027645Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027655Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_1 (SPAdes)EnvironmentalOpen in IMG/M
3300027678Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_M3 (SPAdes)EnvironmentalOpen in IMG/M
3300027698Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP04_OM2 (SPAdes)EnvironmentalOpen in IMG/M
3300027725Agricultural soil microbial communities from Georgia to study Nitrogen management - GA AS200 (SPAdes)EnvironmentalOpen in IMG/M
3300027742Oil polluted marine microbial communities from Coal Oil Point, Santa Barbara, California, USA - Sample 3 (SPAdes)EnvironmentalOpen in IMG/M
3300027783Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP14_OM2 (SPAdes)EnvironmentalOpen in IMG/M
3300027824Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP12_OM3 (SPAdes)EnvironmentalOpen in IMG/M
3300027855Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3 (SPAdes)EnvironmentalOpen in IMG/M
3300027874Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil Plot 1 MoBio (SPAdes)EnvironmentalOpen in IMG/M
3300027894Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Cold Stream Run_MetaG_CSR_2012 (SPAdes)EnvironmentalOpen in IMG/M
3300027910Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2014 (SPAdes)EnvironmentalOpen in IMG/M
3300027915Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Straight Creek_MetaG_SC_2013 (SPAdes)EnvironmentalOpen in IMG/M
3300027949Groundwater microbial communities from the Columbia River, Washington, USA - GW-RW S2_40_50 (SPAdes)EnvironmentalOpen in IMG/M
3300027997 (restricted)Seawater microbial communities from Amundsen Gulf, Northwest Territories, Canada - Cases_109_6EnvironmentalOpen in IMG/M
3300028017Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4Host-AssociatedOpen in IMG/M
3300028598Marine sediment microbial communities from subtidal zone of North Sea - Hel_20160420 (Illumina Assembly)EnvironmentalOpen in IMG/M
3300028717Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_158EnvironmentalOpen in IMG/M
3300028784Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_121EnvironmentalOpen in IMG/M
3300028787Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_381EnvironmentalOpen in IMG/M
3300028866Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N3_2EnvironmentalOpen in IMG/M
3300028889Soil microbial communities from agricultural site in Penn Yan, New York, United States - 12C_Control_Day2EnvironmentalOpen in IMG/M
3300029149Marine sediment microbial communities from University of Hong Kong - Deep-ocean SedimentEnvironmentalOpen in IMG/M
3300029636Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-M (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300029882III_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300029945I_Bog_N2 coassemblyEnvironmentalOpen in IMG/M
3300030659Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_a_PC metaG (v2)EnvironmentalOpen in IMG/M
3300030846Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FB5 EcM (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030939Forest soil microbial communities from Spain - ITS-tags Site 9-Mixed-thinned forest site A9_MS_spring Metatranscriptome (Eukaryote Community Metatranscriptome) (version 2)EnvironmentalOpen in IMG/M
3300030943III_Fen_N2 coassemblyEnvironmentalOpen in IMG/M
3300030967Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - FA11 Emin (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300030998Metatranscriptome of forest soil microbial communities from Montana, USA - Site 5 -Soil GP-3A (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031096Metatranscriptome of soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_RNA_194 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300031198Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 14_SEnvironmentalOpen in IMG/M
3300031199Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 7_SEnvironmentalOpen in IMG/M
3300031226Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_SEnvironmentalOpen in IMG/M
3300031344Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaGHost-AssociatedOpen in IMG/M
3300031565Soil microbial communities from Risofladan, Vaasa, Finland - UN-2EnvironmentalOpen in IMG/M
3300031713Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22EnvironmentalOpen in IMG/M
3300031718Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesECM1C_05EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031768Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.084b2f22EnvironmentalOpen in IMG/M
3300031778Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24EnvironmentalOpen in IMG/M
3300031788Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Bog_T0_2EnvironmentalOpen in IMG/M
3300031797Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f23EnvironmentalOpen in IMG/M
3300031804Marine microbial communities from Western Arctic Ocean, Canada - CB11b_AW_Bot5EnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300031831Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f20EnvironmentalOpen in IMG/M
3300031880Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.168b4f25EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031945Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082EnvironmentalOpen in IMG/M
3300031946Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172EnvironmentalOpen in IMG/M
3300031949Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT98D197EnvironmentalOpen in IMG/M
3300031954Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178 (v2)EnvironmentalOpen in IMG/M
3300032035Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF170EnvironmentalOpen in IMG/M
3300032039Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f21EnvironmentalOpen in IMG/M
3300032053Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16EnvironmentalOpen in IMG/M
3300032054Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f23EnvironmentalOpen in IMG/M
3300032059Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f27EnvironmentalOpen in IMG/M
3300032066Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f18EnvironmentalOpen in IMG/M
3300032089Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23EnvironmentalOpen in IMG/M
3300032091Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f25EnvironmentalOpen in IMG/M
3300032122Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C0D4EnvironmentalOpen in IMG/M
3300032160Sb_50d combined assembly (MetaSPAdes)EnvironmentalOpen in IMG/M
3300032205Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_05EnvironmentalOpen in IMG/M
3300032260Coastal sediment microbial communities from Maine, United States - Merrow Island worm burrowEnvironmentalOpen in IMG/M
3300032272Coastal sediment microbial communities from Maine, United States - Lowes Cove worm burrowEnvironmentalOpen in IMG/M
3300032770Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.5EnvironmentalOpen in IMG/M
3300032893Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_1.1EnvironmentalOpen in IMG/M
3300033290Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15EnvironmentalOpen in IMG/M
3300033489Soil microbial communities from uranium-contaminated site in the Upper Colorado River Basin, Wyoming, United States - RVT95D214EnvironmentalOpen in IMG/M
3300034660Metatranscriptome of lab incibated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - T60R2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
ASHM485C_050572502140918005Coastal Water And SedimentGSSSGIDPKPLQAAVVKSDGGERCRNAGTKIPAGTVEGGERKRTTAEASKAD
FD1_100725602170459024Grass SoilALRGRQSGVDLKPPQAAVVKSDGGERCGNAGDRIPAGTVERGERKRTAAEVSKAV
BBAY58_1002868533300000189Delisea Pulchra's SurfaceVVKSAGGERCGNVGTKIPSGTVERGERKRTIAEVSKAV*
TDF_OR_ARG05_123mDRAFT_107461123300000242MarineGTDPKPPQTAVVKSDGGERCGNAGTMIPTGKVERGERKRTTAEVS*
AF_2010_repII_A001DRAFT_1008251223300000793Forest SoilAVVKSDGGERCGRAGTMFPAGMVERGERKQTADEVSKRD*
JGI12678J13193_100589023300001083Forest SoilAAVVKSDGGERCGKVGTKIPIGMIERGERKRTVDEVSKAV*
JGI12714J13572_100816613300001162Forest SoilADLKPPQAASVKSRGWERCGNAGTMIPAGMVERGERKQTVDEVSKAD*
JGI12660J13575_10025013300001179Forest SoilHGGERCGNVGTMIPAGTVERGERKRTVDEVSKAD*
JGI20191J14862_105357813300001394Arctic Peat SoilALRGRQSGVDLKPPQAAVVKSHGGERCGKAGTXILAGMIERGERKRTAVEVSKSGLDDVKTGG*
JGI20181J14860_101166223300001404Arctic Peat SoilAASVKSRGRERCGNAETMIPAGMVERGERKQTVDEVSKAD*
JGI12635J15846_1087240413300001593Forest SoilDPKPPRAALVKSHGGERCGNVGTMIPTGTVERGERKRTVDEVSKAD*
JGI20264J16347_1016123300001618Forest SoilLRVRQSGADLKPPQAASVKSRGWERCGNAGTMIPAGMVERGERKQTVDEVSKAD*
BIH8_1001272423300002921Delisea PulchraLSGIDPKPPQAAVVKSDGGERCGNVGTKIPSGTVERGERKRTIAEVSKAV*
JGI26344J46810_101877113300003224Bog Forest SoilADPKPPQAAVVKSDGGERCGNVGAMIPAGTVERGERKQTASEASKAD*
Ga0031654_1021520823300003861Freshwater Lake SedimentQVADPKPPQAAVVKSDGGERCGNVGALIPAGKIERGERKQTASEASKAD*
Ga0063294_1058659413300003885Hydrothermal VentsVDPKLPQATVVKSHGGERCGKVGTTIPASTVERGERKRTTAEVSKAD*
Ga0055441_1017287123300004023Natural And Restored WetlandsKPLQAAVVKSDGGERCRNAGAKIPAGTVEGGERKRTTAEASKAD*
Ga0058900_142513923300004099Forest SoilAAVKSRGGERRGNAGTMIPAGMVERGERKQTASEASKAD*
Ga0062386_10153274713300004152Bog Forest SoilKPPQAAVVKSDGGERCGNARAMILAGKVERGERERTVDEVSKAV*
Ga0068960_127237823300004602Peatlands SoilAAAVKSRGGERRGNAGTMIPAGKIERGERKQTASEASKAD*
Ga0066395_1002129113300004633Tropical Forest SoilLSSKSDGGERCRKVGTMIPAGKVERGERKQTASEASKAD*
Ga0066395_1003761633300004633Tropical Forest SoilAVVKSDGGERCGNVGAMISAGKIERGERKQTASEASKSD*
Ga0066813_101565713300005103SoilKPPQAAVVKSDGGERCGKVGATIPAGKVERGERKRIVDEVSKAD*
Ga0066816_101914223300005158SoilADPKPPQAAAVKSHGSERRGKARTMIPAGKVERGERKRTVREVSKAD*
Ga0066388_10429348213300005332Tropical Forest SoilMALRVRQSGADPKPPQAAAVKSRGGERCGNAGTMIPAGMVDGGERKRTAAEASKAD*
Ga0066388_10571307833300005332Tropical Forest SoilPKPPQAAAVKSRGGERCGNVGTVIPAGVVEGGERKRTAAEASKAD*
Ga0066388_10676424413300005332Tropical Forest SoilPPQAAAVKSRGGERCGNVGTVIPAGKVEGGERKRTAAEASKGCLGDVETAG*
Ga0070661_10023457823300005344Corn RhizosphereQSGSGLKPLQAAVVKSDGSERCSQRHEDIPAGEVERGERKRTADELSKAD*
Ga0070674_10183186313300005356Miscanthus RhizospherePKPPRAAAVKSRGGERRGNAWTMIPAGMVERGERKQTASEASKAD*
Ga0008090_1570492333300005363Tropical Rainforest SoilKPPQAAAVKCRGGERCGNAGTMIPAGKVERGERKQTVDEVSKAD*
Ga0070711_10006583133300005439Corn, Switchgrass And Miscanthus RhizosphereALVKSHGGERCGNVGTMIPAGTVERGERKRTVDEVSKAD*
Ga0070711_10071409923300005439Corn, Switchgrass And Miscanthus RhizospherePKPPRAAAVKSRGGERRGNAGTMIPAGKVERGERKQTASEASKAVR*
Ga0070727_1075288013300005590Marine SedimentVVKSHGSERCGKVETMISASTVERGERKRTTAEVSKAA*
Ga0070723_1056853733300005612Marine SedimentLQAAVVKSDGGERQKSRGKIPAGKVQRGERERTVDEVSKAD*
Ga0068856_10236063013300005614Corn RhizosphereVKSHGGERCGNVGTMIPAGTVERGERKRTVDEVSKAD*
Ga0066905_10001624913300005713Tropical Forest SoilVAKYHGGERLRKRWDKIPAGMVEGGERKQTADELSKTD*
Ga0068861_10264960523300005719Switchgrass RhizosphereSRGGERCGNAGTMIPAGTVERGERKRTVSEVSKAD*
Ga0066903_10068327243300005764Tropical Forest SoilADPKPPQAAAVKSRGGERCGKAGTMIPTGKVERGERKRTVR*
Ga0066903_10546060913300005764Tropical Forest SoilRGGERRGNAGTMIPAGKVERGERKQTASEASKAD*
Ga0066383_1003324243300005953MarineQAAVVKSDGGERCGNAGAMTLAGTVERGERKRTTAEVSKAD*
Ga0066789_1019792633300005994SoilPKPPQAALVKSHGGERCGNVGTMIPAGTVERGERKRTVDAVSKAD*
Ga0066790_1038456613300005995SoilPQAAAIKCRGGERCGNAGTMIAAGKVERGERKQTVDEVSKAD*
Ga0066790_1051108323300005995SoilQAALVKSHGGERCGNAGTVIPAGTVERGERKRTVDEVSK*
Ga0075024_10006240523300006047WatershedsSRGGERRGNVGTMIPAGKVERGERKQTASEASKAD*
Ga0075024_10053154613300006047WatershedsAVVKSDGGERCRKVGTMIPAGKVERGERKQTASEASKSV*
Ga0075015_10040163123300006102WatershedsRGCERCGNAGTMIPAGMVERGERKQTVDEVSKAD*
Ga0075030_10018792713300006162WatershedsVKSNGGERCGSAGTMIPAGTVERGERKQTADEVSKRE*
Ga0070715_1072115113300006163Corn, Switchgrass And Miscanthus RhizosphereFGDQVADPKPLQAAVVKSVGGERCRKVGTMIPAGKVERGERKQTK*
Ga0075014_10090465423300006174WatershedsKSDGGERCRNVGTMIPAGMMWEGERKQTAAEASKAE*
Ga0070765_10167014623300006176SoilYRGGERCGNAGTMIPAGKVERGERKQTVEEVSKAD*
Ga0082395_103196523300006235MarineDPKPLQAAVVKSDGGERCRKVGTKIPAGKAQRGERKRTADEVSKAD*
Ga0075021_1088968233300006354WatershedsVKSLGGERCGNAGAMILAGEVERGKRKRTADEVSNAD*
Ga0082250_1000180023300006465SedimentVQRSGADPKLPQAAVVKSHGGERCGKVGTTIPASTVERGERKRTTAEVSKAD*
Ga0074062_1300139933300006606SoilVKSHGGERCGNAGTMIPAGTVERGERKRTVSEVSKAD*
Ga0079222_1001090053300006755Agricultural SoilAAVAKYHGGERLRKRWDKIPAGMVEGGERKQTADEVSKRG*
Ga0075530_106798723300006792Arctic Peat SoilMKEGPSGSVAGIDLKPLQAAVVKSDGGERCRNAGAKIPAGTVEGGERKRTTAEASKAD*
Ga0075428_10143276913300006844Populus RhizosphereKPPQAAAVKSRGGERCGNAGTMIPAGTVEGGERKRTAAEASKSD*
Ga0075425_10284616523300006854Populus RhizosphereADPKPPQAAVVKSDGGERCGKVGATVPAGKVERGERKRIVDEVSKAD*
Ga0066797_127897023300006864SoilPKPPRAALVKSHGGERRGNVGTMIPAGTVERGERKRTVDEVSKAD*
Ga0074063_1427583523300006953SoilGADLKPPQAAAVKSRGGERCGNAGTMIPAGTVERGERKQTVDEVSKAV*
Ga0099791_1011784913300007255Vadose Zone SoilAHTSDRGERCRKVGTMIPAGKVERGERKQTASEASKSD*
Ga0099791_1050769313300007255Vadose Zone SoilVLIPSHQQAAAVKRRGGERCGNAGTMIPAGKVERGERKQTVDEVSKAD*
Ga0099795_1009779133300007788Vadose Zone SoilADPKPPQAAVVKSHGGERCGNAGTMIPAGTVERGERKQTVSEVSKAD*
Ga0115371_1004638023300008470SedimentPQAAVVKSHGGERCGKVETMISASTVERGKRKRTTSEVSKAD*
Ga0115371_1017685213300008470SedimentLRDRSSETGPKPPQAAVVKSDGGKRCGKAGTMIPAGMVERGERKRTAVDVSKIP*
Ga0105244_1027021323300009036Miscanthus RhizosphereLRVRQSGADPKPLQAAAVKSRGGERCSQVWAKAQAVERGERKQTVDEVSKAD*
Ga0099829_1064239513300009038Vadose Zone SoilRGRQSGAGLKPLQAAVVKSDGSERCSQRRDDIPAGEVERGERKRTVDEVSKAD*
Ga0099828_1154786213300009089Vadose Zone SoilKSHGGERCGKVGTMIPAGKVERGERKQTASEASKAD*
Ga0114129_1049426413300009147Populus RhizosphereKPPQAAAVKSRGGERCGNVGTMNPAGMVERGERKRTAAEVSKAD*
Ga0111538_1036459313300009156Populus RhizosphereKPLQAAAVKSRGGERCSQVWAKAQAVERGERKQTVDEVSKAD*
Ga0105241_1188220513300009174Corn RhizosphereKSRGGERCGKVGTMIPAGMVERGERKQTAAESAYV*
Ga0105248_1015231353300009177Switchgrass RhizosphereDPKPPRAALVKSHGGERCGNVGTMIPAGTVERGERKRTVDEVSKAD*
Ga0105248_1026235623300009177Switchgrass RhizosphereALRVRRSGADPKPPQAAAVKSRGGERCGNAGTMIPAGTVERGERKRTVDEVSKAV*
Ga0114925_1033922613300009488Deep SubsurfacePQTAVVKSDGGERCGNAGTMIPAGTVEGGERKRTTAEAS*
Ga0114925_1099825913300009488Deep SubsurfaceVKSHGSERCGKVGTMIPASTVERGERKRTTSEVSKAD*
Ga0116108_119811713300009519PeatlandKSHGGERRGNAGTMISAGTVERGERKRTVDEVCRNRIR*
Ga0116220_1024576113300009525Peatlands SoilQVADPKPPQAAVVKSDGGERCGNVGAMIPAGKIERGERKQTASEASKAV*
Ga0105237_1139974413300009545Corn RhizospherePPQAVVVKINGGERCGSAGTMIPAGTVERGERKQTADEVSKRD*
Ga0105249_1270531313300009553Switchgrass RhizosphereKPPRAALVKSHGGERCGNVGTMIPAGTAEGGERKRTVDEVSKAD*
Ga0116120_109174113300009641PeatlandAAAVKSRGSERCGNAGTKILAGKVERGERKRTAAEASKAD*
Ga0116120_117031823300009641PeatlandLKPPQAAVVKSDGGERCGKVGTKILTGTVERGERKQTADEVSKAD*
Ga0116110_112899433300009643PeatlandRQSGADFKPPQAAVVKSNGGERCGSRDMIPAGTVERGERKQTADEVSKTD*
Ga0116106_119740513300009645PeatlandAAAAKCRGGERCGNTGTMIPAGTVERGERKQTVDEVSKAD*
Ga0116132_106924513300009646PeatlandQVADPKPPRAAAVKSRGGERRGNVGTMIPAGKVERGERKQTASEASKAD*
Ga0105858_109691213300009661Permafrost SoilVADPKPPRAALVKSHGGERCGNVGTMIPAGTVERGERKRTVDEVSKAD*
Ga0116215_105868123300009672Peatlands SoilKSDGGERCRKVGTMIPAGKVERGERKQTASEASKSD*
Ga0116224_1042723113300009683Peatlands SoilQVADPKPPQAAVVKSDGGERCGKVGTRIPAGKVERGERKRTAAEVSKAD*
Ga0105062_112488623300009817Groundwater SandPPQAAAVKSRGGERCGNAGTMIPAGTVERGERKRTADEVSKAD*
Ga0126380_1007482213300010043Tropical Forest SoilPKPLQAAVVKSDGGERCRKVGTMIPAGQVERGERKQTASEASKSD*
Ga0126380_1015739413300010043Tropical Forest SoilKPPQAAAVKSRGGERCGKAGTMIPTGKVERGERKRTVDEVSKRD*
Ga0126380_1205863723300010043Tropical Forest SoilPKPLQAAVVKSDGGERCRKVGTMIPAGKVERGERKQTASEASKAD*
Ga0126382_1211312313300010047Tropical Forest SoilLVKSQGGERCGNVGTMIPAGTVERGERKRTVDEVSKAD*
Ga0126382_1214878613300010047Tropical Forest SoilAEPKPLQAAAVKCRGGERCSQGSDISLAGGIEGGERKRTAAEASKAD*
Ga0126319_155769323300010147SoilDLKPPQAAVVKSHGGERCGKVGTMIPTGMIERGERKRTVSEVSKCD*
Ga0126370_1237246613300010358Tropical Forest SoilLQAAVVKSDGGERCRKVGTMIPAGKVERGERKQTASEASKAD*
Ga0126376_1010676813300010359Tropical Forest SoilPKPLQAAVVKSDGGERCRKVGTMIPAGKVEGGERKQTDSEASKAD*
Ga0126376_1129130233300010359Tropical Forest SoilPLQAAVVKSDGGERCRKVGTMIPAGKVERGERKQTASEASKSD*
Ga0126376_1170956023300010359Tropical Forest SoilLKPPQAAVVKSHGGERCGKVGTMIPAGMVEGGERKRTAAEVSKGD*
Ga0126372_1033315413300010360Tropical Forest SoilSRGGERCGNVGTVIPAGKVEGGERKRTAAEASKAD*
Ga0126372_1121381913300010360Tropical Forest SoilVKRRGGERCGNAGTMIPAGKVERGERKQTVDEVSKAD*
Ga0126372_1126187213300010360Tropical Forest SoilQAAAVKSRGGERCGKRRDKIPAGTVERGERKRTAAEVSKAD*
Ga0126378_1288804813300010361Tropical Forest SoilRQSGVDLKPPQVASVKSRGDERCGNAGTMIPAGTVERGERKRTAAEASKAD*
Ga0126377_1304222523300010362Tropical Forest SoilADFKPPQAAVVKSDGGERCGSAGTMFPAGMVERGEREQTADEVSKRD*
Ga0126381_10190851813300010376Tropical Forest SoilASVKSRGDERCGNAGTMIPAGTVERGERKRTAAEASKAD*
Ga0126381_10443067113300010376Tropical Forest SoilPQAAAVKSRGSERCGNVGTEIPAGKVEGGERKRTAAEASKAD*
Ga0126381_10461235623300010376Tropical Forest SoilVVKSHGDERCGNAGTMIPAGGVERGERKRTVSEVSKAD*
Ga0136449_10257117213300010379Peatlands SoilSRGGERCGNAGTKILAGKVERGERKRTVDEVSKAD*
Ga0134124_1041875913300010397Terrestrial SoilGSGLKPLQAAVVKSDGSERCSQRHEDIPAGEVERGERKRTADELSKAD*
Ga0126383_1010938713300010398Tropical Forest SoilKPPQAAVVKSDGGERCGNVGAMISAGKIERGERKQTASEASKSD*
Ga0126383_1363195613300010398Tropical Forest SoilKSRGDERCGNAGTMIPAGTVERGERERTAAEVSKAD*
Ga0126344_127167313300010866Boreal Forest SoilSHGGERCGNVGTMIPAGTVERGERKRTAAEVSKAG*
Ga0124844_123022923300010868Tropical Forest SoilAVKSRGGERCGNVRTVILAGKVVGGERKRTAAEASKAD*
Ga0150983_1381194513300011120Forest SoilPPQAAVVKSDGGERCGNVGAMIPAGKIERGERKQTASEASKSD*
Ga0137325_110593113300011415SoilQAAAVKSRGGERCGNVGTMIPAGKVERGECKRTAFEASKSD*
Ga0137432_121879113300011439SoilMKEALRGRQSGVDLKPPQAAVVKSDGGERCGKAGTKIPAGTVERGERKQTADEVSKSD*
Ga0137389_1045764723300012096Vadose Zone SoilKCRGGERCGNAGTMIPAGKVERGERKQTVEEVSKAD*
Ga0153943_103206833300012177Attine Ant Fungus GardensMALRGRQSGVDLKPPQAAVVKSDGGERCGKVGTKIPAGKVERGERKQTVDEVSKAD*
Ga0137382_1054048113300012200Vadose Zone SoilADPKAPQAAVVKSDGGERRGNVGAVISAGKIERGERKQTN*
Ga0137365_1107125413300012201Vadose Zone SoilQSGVDLKPPQAAVVKSHGGERCGKARTMILAGTVERGERKRIVDEVSKAD*
Ga0137378_1035087223300012210Vadose Zone SoilSYQSYGGERCGNVGAMIPAGMVERGERKRAAAEVSKAD*
Ga0137447_109459723300012226SoilFRGRLSGIGLKPPQAAVVKSDGGERCGKAGTKIPAGTVERGERKRTADEVSKSD*
Ga0137361_1007036363300012362Vadose Zone SoilAAVVKSHGGERCGNVGAMIPAGMVERGERKRTVAEVSKAD*
Ga0137361_1100711913300012362Vadose Zone SoilPPQAALVKSHGGERCGKVGTMIPAGTVERGERKRTVDVKRIR*
Ga0134044_100284713300012395Grasslands SoilKSHGGERCGNVGTMIPAGTVERGERKRTVDEVSKRLR*
Ga0153928_106541413300012677Attine Ant Fungus GardensASVKSRGCERCGNAGTMIPAGMVGRGERKQTVDEVSKAD*
Ga0137397_1028077913300012685Vadose Zone SoilVADPKPPRAAAVKSRGGERRGNVGTMIPAGMVERGERKRTASEASKAD*
Ga0137395_1050402213300012917Vadose Zone SoilKCRGGERCGNAGTMIPAGTVERGERKQTVDEVSKAD*
Ga0137416_1070372813300012927Vadose Zone SoilLQAAAVKSRGGERCSQVWAKSPGGKVERGERKQTVDEVSKAD*
Ga0137410_1010991913300012944Vadose Zone SoilPKPPQAAAVKSRGGERCGNAGTMIPAGTVERGERKRTADEVSKAD*
Ga0126369_1131069923300012971Tropical Forest SoilMAKYHGGERCGNAGTMIPTGKVERGERKRTVDEVSKAD*
Ga0164309_1178874623300012984SoilQVADSKPPQAAAVKSRGGERCGKVGTMIPAGMVERGERKRTAAEASKFS*
Ga0164320_1068164313300013098Marine SedimentAAVAKSHGGERCGNVGTMIPAGTVERGERKRTTAEVSKAD*
Ga0163162_1201448713300013306Switchgrass RhizosphereMRNWQSGAGLKPLQAAVVKSDGGERCSQLWDHIPAGEVERGERKQTVDEVSKAD*
Ga0120179_112679723300013763PermafrostLQAAAAKSRGGERCSQVWAGSPDGKVERGERKQTVDEVSKAD*
Ga0181530_1016215213300014159BogKSNGGERCGSRDIIPAGTVERGERKQTADEVSKRD*
Ga0075327_102513413300014272Natural And Restored WetlandsGSGLKPLQAAVVKSDGGERCSQRREDIPAGEVERGERKRTAAEVSKAD*
Ga0182024_1284983913300014501PermafrostQAALVKSHGGERCGNVGTMIPAGTVERGERKRTVDEVSKAG*
Ga0182041_1049486823300016294SoilSGADPKPPQAAAVKSRGGERCGHAGTMILAGTVEKGERKRTADEVSKGD
Ga0182041_1210871913300016294SoilRVRQSGADPKPLQAATAKSPGGERCSQVWAGSPDGKVERGERKQTVDEVSKAD
Ga0182033_1054026223300016319SoilMTSFMETINLSRGRLSGTGLKPLQAAVVKSDGGERCSQRRENIPAGEVERGERKRTADELSKAD
Ga0182035_1075816723300016341SoilPKPPQAAVVKSHGGERCGNAGTMIPAGKVGRGECKQTVDEVSKAD
Ga0182034_1021261513300016371SoilKSHGGERCGNVGAMIPAGTVERGERKRSLGEYPIYI
Ga0182040_1013617413300016387SoilAAVVKSDGGERCGNVGAMISAGKIERGERKQTASEASKSD
Ga0182040_1038076613300016387SoilLRVRQSGADPKPPQAAAVKSCGGERCGNAGTMILAGTVERGERKRTADEVSKAD
Ga0182040_1198536423300016387SoilADLKPPQAAAVKSRGGERCGNVGTMIPVGTVERGERKRTAAEASKSD
Ga0182039_1011587213300016422SoilGEGLKPLQAAVVKSDGGERCSQRWDHIPAGEVERGERKQTVDEVSKAD
Ga0182039_1196443513300016422SoilSRGGERRGNARTMIPAGKIERGERKQTASEASKAD
Ga0187807_127522523300017926Freshwater SedimentDPKPPQAAVVKSDGGERCGNARTMILAGKVERGERKRTAEEVSKGD
Ga0187779_1109076013300017959Tropical PeatlandALVKSQGSERCGKGRAMTLLGRDQGGERKRTTAEVSK
Ga0187805_1036789423300018007Freshwater SedimentLRVRQSGADPKPPQAAAVKSRGSERCGNAGTVILAGKVERGERKRTADEVSKAD
Ga0187888_124143413300018008PeatlandVRQSGVDLKPPQAAVVKSDGGERCGKVGTKILTGTVERGERKQTVDEVSKAD
Ga0187874_1045221113300018019PeatlandPKPPRAALVKSHGGERCGNVGTMIPAGTVEGGERKRTVDEVSKCD
Ga0187861_1034299613300018020PeatlandPQAAAIKCRGGERCGNAGTMIPAGKVERGERKQTVDEVSKAN
Ga0187864_1009871813300018022PeatlandSVKSRRCERCGNAETMIPAGMVERGERKQTVDEVSKAD
Ga0187787_1021197023300018029Tropical PeatlandVKSYGGERRGNAGTMILAGTVERGERKRTTAEASKAD
Ga0187788_1004660643300018032Tropical PeatlandADPKPPRAAVVKSYGGERRGNAGAMIPAGTVERGERKRTVSEVSKAD
Ga0187788_1010259923300018032Tropical PeatlandDPKPPQAAAVKSRGGERCGNAGTMILAGTVERGERKQTADEVSKAD
Ga0187867_1005526713300018033PeatlandSGADLKPPQAAVVKSDGGERCGKVGTKILTGTVERGERKQTADEVSKRD
Ga0187863_1069850313300018034PeatlandKSRSCERCGNAGTMIPAGMVERGERKQTVDEVSKAD
Ga0187875_1032741433300018035PeatlandSGADLKPPQAAVVKSDGGERCGKVGTKILTGTVERGERKQTADEVSKAD
Ga0187766_1011999113300018058Tropical PeatlandADPKPPQAAAVKSCGGERCGNAGTMILAGTVERGERKRTADEVSKAD
Ga0187765_1056817713300018060Tropical PeatlandPKPPQAAAVKSRGGERCGNVGTVIPAGKVEGGERKRTAAEASKAD
Ga0187784_1096610113300018062Tropical PeatlandLQAAVVKSDGGERCRKVGTMIPAGKVERGERKQTASEASKAD
Ga0190268_1053054323300018466SoilRQSGVDLKPPQAAVVKSDGGERCGNAGTKIPAGKVERGERKQTK
Ga0066662_1226112713300018468Grasslands SoilMKEALRVRQSGADLKIPQAAAVKSRGGERCGNVGTVIPAGKVEEGERKRTAAEASKAD
Ga0184586_12779713300019194SoilSDGGERCGNVGTMIPAGKIERGERKQTASEASKAD
Ga0180114_106663113300019232Groundwater SedimentPQAAVVKSDGGERCGKAGTKIPAGTVERGERKQTADEVSKSD
Ga0180117_111594823300019248Groundwater SedimentVKSDGSERCGNVGAMTPAGKVERGERKQTADEVSKTD
Ga0181508_132722213300019256PeatlandEVLRVRQSGADPKPPQAAAVKSRGSERCGNAGTKILAGKVERGERKRTADEVSKAT
Ga0137408_139660313300019789Vadose Zone SoilVKSRGGERRGNAGTMIPAGMVERGERKQTASEASKAD
Ga0179590_109931523300020140Vadose Zone SoilKPLQAAVVKSDGGERCRKVGTMIPAGKVERGERKQTASEASKAD
Ga0212168_121535333300020231SedimentGFKPLQAAVVKSDGGERCRNVGTMIPAGKAQRGERKRTVDEVSKAD
Ga0211691_1015254213300020447MarineKPPQAAVVKSDGGERCGNAGTMILASMVERSERKRTTAEVSKAD
Ga0210407_1047082933300020579SoilKIHGGERCGKVGTMIPTGTVERDERKRTASEASKRD
Ga0210381_1026806323300021078Groundwater SedimentLKPPQAAVAKRHGGERCGNARTMIPAGTVERGERKRTAAEVSKAD
Ga0179596_1069141713300021086Vadose Zone SoilPPQAASVKSRGWERCGNAGTMIPAGMVERGERKQTVDEVSKAD
Ga0210408_1004008833300021178SoilLVKSHGGERCGNVGTMIPAGTVERGERKRTVDEVSKAD
Ga0210394_1098347323300021420SoilPKAPQAALVKSHGGERCGNVGTMIPAGMVERGERKRTVDEVSKAD
Ga0210394_1150753913300021420SoilAVVKSDGGERCGNVGAMIPAGKIERGERKQTASEASKSD
Ga0210394_1185385323300021420SoilAALVKSHGGERCGNVGTMIPAGTVERGERKRTVDEVSKAD
Ga0210384_1008986113300021432SoilRAALVKSHGGERCGNVGTMIPAGTVERGERKRTVDEVSKAD
Ga0210392_1012715013300021475SoilPKPLQAAAAKSRGCERCSQVWAGSPDGKVERGERKQTVDDVSKRD
Ga0187846_1031072013300021476BiofilmSDGGERCRKVGTMIPAGKVERGERKQTASEASKAVR
Ga0210402_1049574513300021478SoilMKEGPSDPKPPQAAAVKCRGGERCGNAGTRIPAGKVERGERKQTVDEMSKAD
Ga0126371_1070769923300021560Tropical Forest SoilASVKSRGDERCGNAGTMIPAGTVERGERKRTAAEASKAD
Ga0213851_112550013300021860WatershedsPQAAVVKSHGGERCGNAGTMIPAGTVERGERKRTVSEVSKAD
Ga0224508_1069404413300022413SedimentARSSGIDPKPLQAAVVKSDGGERCRNAGAKIPAGTVEGGERKRTTAEASKAD
Ga0242655_1026078313300022532SoilQSGADPKPPQAAVVKSDGGERCGNAGAMVLAGKVERGERKRTAAEVSKAD
Ga0209997_1021875513300024058Deep SubsurfaceAAVVKSHGGERCGKVGTMIPASTVERGERKRTTAEVSKAD
Ga0209987_1015948313300024060Deep SubsurfaceVVKSDGGERCGNAGAMIPAGTVERGERKRTTAEVSKAD
Ga0209987_1049623713300024060Deep SubsurfaceRKALRVRSSGTDPKPPQAAVVKSDGGERCGNAGAMIPAGTVERGERKRTTAEVSKAD
Ga0228598_111788813300024227RhizosphereKSRGWERCGNAGTMIPAGMVERGERKQTVDEVSKAD
Ga0209976_1006978313300024265Deep SubsurfaceKPPQTAVVKSDGGERCGNAGTMIPAGTVEGGERKRTTAEAS
(restricted) Ga0233449_100391993300024302SeawaterDPKPLQAAVVKSDGGERCRNVGALTPAGKVKRGERKRTTAEVSKAD
Ga0209991_1040012223300024429Deep SubsurfaceQAAVVKSDGGERCRNAGAKIPAGTVEGGERKRTTAEASKAD
Ga0209977_1005180913300024432Deep SubsurfaceVVKSDGGERCGNAGTMIPAGTVEGGERKRTTAEAS
Ga0209977_1034827323300024432Deep SubsurfaceAVVKSHGSERCGKVGTMIPASTVERGERKRTTAEVSKAA
Ga0209977_1038696113300024432Deep SubsurfaceSGTDPKPPQAAVVKSDGCERCGNVGTMIPAGMVERGERKRTTAEVSKAD
Ga0209977_1053165613300024432Deep SubsurfaceGADLKPPQAAAVKSRGGERCGNAGAMILAGTVERGERKRTAAEVSKAD
Ga0208455_101667433300025453PeatlandQSGADFKPPQAAVVKSNGGERCGSRDMIPAGTVERGERKQTADEVSKRD
Ga0208563_111168523300025501PeatlandSAVVKSDGGERCGKVGTKILTGTVERGERKQTADEVSKAD
Ga0208188_107683913300025507PeatlandKPPQAAVVKSNGGERCGSRDMIPAGTVERGERKQTADEVSKTD
Ga0209386_106439513300025582Arctic Peat SoilKPPRAALVKNHGGERCGNVGTMIPAGTVERGERKRTVDEVSKAD
Ga0209386_109815013300025582Arctic Peat SoilVKSHGSERCGKVETMISASTVERGERKRTTAEVSKAD
Ga0209826_124758913300025693Methane Seep MesocosmAAVVKSDGGERCRNVGAMTPSGKVKRGERKRTTAEVSKAD
Ga0209638_115322313300025725Arctic Peat SoilVRQSGADPKPLQAAAAKSRGGERCSQVWAGSPDGKVERGECKQTVDEVSKAD
Ga0209199_1001339313300025809Pelagic MarineMSDGGERFRNVGALTPAGKVKRDERKRTTAEVSKAD
Ga0209585_1051394013300025891Arctic Peat SoilPKPPRAALVKSHGGERCGNAGTVIPAGTVERGERKRTVDEVSKAD
Ga0207692_1083591213300025898Corn, Switchgrass And Miscanthus RhizosphereALVKSHGGERCGNVGTMIPAGTVERGERKRTVDEVSKAD
Ga0207680_1137611113300025903Switchgrass RhizosphereVKSRGGERCGNAGTMIPAGTVERGERKRTVDEVSKAV
Ga0207699_1130469713300025906Corn, Switchgrass And Miscanthus RhizosphereSHGGERCGNVGTMIPAGTVERGERKRTVDEVSKAD
Ga0207701_1150089923300025930Corn, Switchgrass And Miscanthus RhizosphereVVKSHDRERRGNVGTMIPAGMIERGERKRTASEASKAD
Ga0207677_1159482913300026023Miscanthus RhizospherePKPPQAAVVKSHGGERCGNAGTMIPAGTVERGERKRTVSEVSKAD
Ga0208780_102040023300026046Natural And Restored WetlandsGSGLKPLQAAVVKSDGGERCSQRREDIPAGEVERGERKRTADELSKAD
Ga0207641_1151464013300026088Switchgrass RhizosphereDLRPPQAAAVKSRGGERCGNAGTMIPAGTVERGERKRTVDEVSKAV
Ga0207683_1036533823300026121Miscanthus RhizosphereALVKSHGGERCGNVGTKIPAGTVERGERKRTVDEVSKAD
Ga0209848_100489013300026221Permafrost SoilKPPRAALVKSHGGERRGNVGTMIPAGTVERGERKRTVDDVSKRD
Ga0209839_1003735513300026294SoilLRVRQSGADPKPLQAAAAKSRGGERSSQVWAGSPDGKVERGERKQTVDEVSKAD
Ga0209235_117829623300026296Grasslands SoilRAALVKSHGGERCGNVGTMIPAGTVERGERKLTVDEVSKAD
Ga0257180_101252413300026354SoilPQAALVKSHGGERCGKVGTMIPAGTVERGERKRTVDEVSKAD
Ga0257149_101249613300026355SoilPQAASVKSRGCERCGNAGTMIPAGMVERGERKQTVDEVSKAD
Ga0257155_102980823300026481SoilVKCRGGERCGNAGTMIPAGKVERGERKQTVDEVSKAD
Ga0257159_106309013300026494SoilAASVKSRGCERCGNAGTMIPAGMVERGERKQTVDEVSKAD
Ga0257157_100649523300026496SoilSGADLKPPQAASVKSRGWERCGNAGTMIPAGMVERGERKQTVDEVSKAD
Ga0257157_108795013300026496SoilGADPKPPQAAAVKSRGGERCGNAGAMIPAGKVERGERKRTADEVSKAD
Ga0207454_10279123300026746SoilSDGGERCGKVGATIPAGKVERGERKRIVDEVSKAD
Ga0207801_10130713300026810Tropical Forest SoilPKPPRAAAVKSRGGERRGNVGTMIPAGKVERGERKQTASEASKAD
Ga0208893_100316213300026857SoilHRKLLWVKSHGGERCGNAGTMIPAGTVERGERKRTVSEVSKAD
Ga0207746_101695023300026865Tropical Forest SoilRKVLRGRQSGSGLKPLQAAVVKSDGGERCSQRRENIPAGEVERGERKRTVDELSKAD
Ga0207858_101698323300026909Tropical Forest SoilVADPKPPRAALVKSHGGERCGNVGTMIPAGTVERGERKRTVDEVSKAD
Ga0209884_102961513300027013Groundwater SandSHGREHRGNVGTMIPAGMIERGERKRTASEASKAD
Ga0207815_103377813300027014Tropical Forest SoilQSGADLKPPQAAAVKGRGGERCGNAGTMIPAGKVERGERKQTVDEVSKAD
Ga0209327_103294213300027307Forest SoilQVTDPKPPQAAVVKSHGGERCGNAGTMIPAGTVERGERKRTVSEVSKAD
Ga0207601_10953713300027461SoilPKPPQAAVVKSDGGERCGKVGATIPAGKVERGERKRIVDEVSKAD
Ga0208199_103280233300027497Peatlands SoilPPQAASVKSRGCERCGNAGTMIPAGMVERGERKQTVDEVSKAD
Ga0209622_100726843300027502Forest SoilKSDGGERCGNVGTMIPAGMVERGERKRIAAEVSKAD
Ga0209684_103703633300027527Tropical Forest SoilAAAVKSRGGERCGNVGTAIPAGMVEGGERKRTAAEASKGD
Ga0209419_101521313300027537Forest SoilDLKPPQAASVKSRGCERCGNAGTMIPAGMVERGERKQTVDEVSKAD
Ga0208043_106211113300027570Peatlands SoilAAVKSRGGERRGNAGTMIPAGKVERGERKQTASEASKAD
Ga0209527_101296623300027583Forest SoilSGADPKPPQAAAVKSRGGERCGNAGTMILAGKVERGERKRTADEVSKAD
Ga0209076_118515713300027643Vadose Zone SoilDPKPPQAAAVKRRGGERCGNAGTMIPAGKVERGERKQTVDEVSKAD
Ga0209117_106503713300027645Forest SoilALVKSHGGERRGNVGTMIPAGTVERGERKRTVDDVSKRD
Ga0209388_123265513300027655Vadose Zone SoilVLIPSHQQAAAVKRRGGERCGNAGTMIPAGKVERGERKQTVDEVSKAD
Ga0209011_104599433300027678Forest SoilGADPKPLQAATAKSRGGERCSQVWAGSPDGKVERGERKQTVDEVSKAD
Ga0209446_101104433300027698Bog Forest SoilLKPLQAAVVKSDGGERCSKRRDLIPSGMVWRGERKQVRRETGKE
Ga0209178_112864113300027725Agricultural SoilSGSGLKPLQAAVVKSDGGERCSQRREDIPAGEVERGERKRTAAEVSKAD
Ga0209121_1006335523300027742MarineSSGIDLKPLQAAVVKSDGGERCRNAGAKIPAGTVEGGERKRTTAEASKAD
Ga0209121_1025997313300027742MarinePQTAVVKSDGGERCGNAGTMIPAGKVERGERKRTTAEVS
Ga0209448_1024675213300027783Bog Forest SoilPKPPRAALVKSQGGERCGNVGTMIPAGTVERGERKRTVDEVSKAD
Ga0209040_1009945223300027824Bog Forest SoilQAAAVKSRGGERCGDTGAMIPAGKVERGERKRTADEVSKAD
Ga0209693_1048175423300027855SoilLQAAFVKSDGGERCRKVGTMIPAGKVERGERKQTAFEASKAD
Ga0209693_1050202413300027855SoilDPKPPQAALVKSHGGERCGKVGTMIPAGTVERGERKRTVDEVSKAD
Ga0209465_1004899313300027874Tropical Forest SoilSDGGERCRKVGTMIPAGKVERGERKQTASEASKAD
Ga0209068_1075990613300027894WatershedsPKPLQAAFVKSDGGERCRKVGTMIPAGKVERGERKQTASEASKSD
Ga0209583_1003140633300027910WatershedsGADPKPLQAAAAKSRGGERCSQVWAGSPDGKVERGERKQTVDEVSKAD
Ga0209069_1055716323300027915WatershedsRVRQSGADPKPPQAAAVKFRGGERCGNARTMIPAGKVERGERKQTVDEVSKAD
Ga0209069_1062423423300027915WatershedsMVKSHGGERCGNAGTTIPAGKVERGERKRTADDVSKAI
Ga0209860_105636813300027949Groundwater SandAAVKSRGGERRGNVGTMIPAGMVERGERKRTAVEASKAE
(restricted) Ga0255057_1006084423300027997SeawaterLRVRSSGIDPKPLQAAVVKSDGGEHCRNAGAKIPAGTVEGGERKRTTAEASKAD
(restricted) Ga0255057_1028256313300027997SeawaterSGADPKLPQAAVVKSHGGERCGKVGTMIPASTVERGERKRTTAEVSKAD
Ga0265356_101773433300028017RhizosphereASVKSRGGERRGNVGTMIPAGTVERGERKRTASEASKAD
Ga0265306_1013823023300028598SedimentGIDPKPPQAAAVKSRGGERCGNAGTMIPAGTVERGERKRTTAEVSKAD
Ga0307298_1001702233300028717SoilKPPQAAAAKCRGGERCGNAGTMIPAGTVERGERKRTADDVSKAD
Ga0307282_1008549423300028784SoilQAAAAKCRGGERCGNAGTMIPAGTVERGERKRTADDVSKAD
Ga0307323_1025992333300028787SoilAAKCRGGERCGNAGTMIPAGTVERGERKRTADDVSKAD
Ga0302278_1047245213300028866BogQSGADPKPLQAAAVKSRGGERCSQVWARSPDGEVERGERKQTVDEVSKAD
Ga0247827_1104067713300028889SoilQAAVVKSRGGERCGNVGTMIPAGTVERGERKRIVDEVSKAD
Ga0119977_10010113300029149Deep-Ocean SedimentSGADPKLPQAAVVKSHGGERCGKVGTMIPASTVERGERKRTTAEASKAD
Ga0222749_1059215223300029636SoilALRGRQSGVDLKPPRAAAVKIHGGERCGKSRNKIPAGTIERGERKQTVDEVSKADY
Ga0311368_1094001213300029882PalsaVADPKPPRAAAAKSRGGERRGNVGTMIPAGKVERGERKQTASEASKAD
Ga0311330_1007657943300029945BogSHGGERCGNVGTKIPAVAVERGERKRTVDEVSKAD
Ga0316363_1026256223300030659Peatlands SoilPKPPQAAVIKSDGGERCGNVGAMIPAGKVERGERKQTASEASKAD
Ga0316363_1028214423300030659Peatlands SoilPPQAAAVKCRGGERCGNAGTMILAGKVERGERKRTADEVSKAD
Ga0075403_1002186413300030846SoilVKSHGGERCGNAGTMIPAGTVERGERKRTVSEVSKAD
Ga0138303_141818623300030939SoilVRQSGADPKSPQAAAVKSRGGERCGNARTVILAGKVERGERKRTADEVSKAD
Ga0311366_1169906023300030943FenMKEGPSGSAKPPQAAVVKSDGGERCGNVGAMISAGKIERGERKQTASEASKSD
Ga0075399_1135204713300030967SoilQSGADLKPPQAAVVKSDGGERCGNVGTMIPAGKIERGERKQTVDEVSKAV
Ga0073996_1229461323300030998SoilVRQSGADLKPPQAASVKSRGWERCGNAGTMIPAGMVERGERKQTVDEVSKAD
Ga0308193_105426813300031096SoilLKPPQAAAAKCRGGERCGNAGTMIPAGTVERGERKRTADDVSKAD
Ga0307500_1003000413300031198SoilMAKYHGGERCGNAGTMIPVGTVEGGERKQTADEVSKAD
Ga0307495_1001248313300031199SoilAAAVKSRGGERCGTPGQDSGSTVERGERKRTAAEVSKAD
Ga0307497_1015717813300031226SoilAAAVKSRGGERRGNVGTMIPAGKVERGERKQTASEASKAD
Ga0265316_1066225613300031344RhizosphereVRQSGADLKPPQAASVKSRGCERCGNAGTMIPAGKVERGERKQTVDEVSKAD
Ga0307379_1145179423300031565SoilVVKSDGGERCRKVETKISAGTMREGERKRTVAEASKAD
Ga0318496_1059821413300031713SoilKLLRLKSRGGERCGNAGTMIPAGKVGRGECKQTVDEVSKAD
Ga0307474_1005168253300031718Hardwood Forest SoilDPKPPRAALVKSHGGERCGNVGTMIPAGTVERGERKRTVEEVSKAD
Ga0307474_1013669333300031718Hardwood Forest SoilAAAKSRGGERCSQVWAGSPDGKVERGERKQTVDEVSKAD
Ga0307468_10221968813300031740Hardwood Forest SoilAVKCRGGERRGNVGTMIPAGMVERGERKRTAAEASKAD
Ga0318509_1007371423300031768SoilRGRQSGEGLKPLQAAVVKSDGGERCSQRWDYIPAGEVERGERKQTVDEVSKAD
Ga0318498_1044266813300031778SoilDPKPPRAALVKSHGGERCGNVGAMIPAGTVERGERKRTVDEMSKAD
Ga0302319_1023381713300031788BogALRVRQSGADLKPPQAASVKSRGCERCGNAGTMIPAGKVERGERKQTVDEVSKAD
Ga0318550_1032693623300031797SoilPPQAATVKSRRGERCGKRRNVIPSGMAQRDERKQTADDVSKV
Ga0310124_1062558913300031804MarineAAAVKSPGSERCGIVGTMIPASMVERGERKRTADKASKSD
Ga0307473_1056594923300031820Hardwood Forest SoilPPQAAVVKSDGGERCGNVGAMISAGKIERGERKQTASEASKAD
Ga0307473_1126557413300031820Hardwood Forest SoilRRSGAEPKPLQAAAVKSRGGERCSQGSDNSPAGEIEEGERKRTAAEASKAD
Ga0318564_1039500913300031831SoilGADLKPPQAAAVKSRGGERCGKRRDEIPAGTVERGERKRTAAEVSKTD
Ga0318544_1041590813300031880SoilSGVDLKPPQAAVVKSDGGERCGKRRDMIPAGMVERGERKRTAAEASK
Ga0306921_1204297813300031912SoilMRAAALKSHGGERRGKVGTMIPADMVERGERKRTVAEA
Ga0310913_1005607943300031945SoilAPQAAAIKCRGGEPCGKAGTTILAGKVERGERKQTN
Ga0310913_1011762313300031945SoilRQSGSGLKPLQAAVVKSDGGERCSQRRENIPAGEVERGERKRTADELSKAD
Ga0310910_1104843713300031946SoilQAAAAKSRGGERCSQVWAGSPDGKVERGERKQTVDEVSKAD
Ga0214473_1048857923300031949SoilSGADLKPLQAAAVKSRGGERCSQVWAEAQAGMVERGERKRTAAEASKAD
Ga0306926_1293391113300031954SoilKSNGGERCGKRRDKIPAGKVERGERKRTAAEVSKA
Ga0310911_1018893323300032035SoilAVKSRGGERCGNVATMIPTGKVERGERKQTVREVSKAD
Ga0318559_1028719313300032039SoilKPPQAATGKSRGGERCGNAETKISAGTVEKGERKRTAAEVSKAD
Ga0315284_1096792423300032053SedimentVRQSGADPKPLQAAAVKSHGGERCSQVWAGSPDGKVERGERKQTVDEVSKAD
Ga0318570_1002947033300032054SoilADPKPPQAAVVKSDGGERCGNVGAMISAGKIERGERKQTASEASKSD
Ga0318533_1014924833300032059SoilSDGGERCGNVGAMISAGKIERGERKQTASEASKSD
Ga0318514_1071290623300032066SoilADPKPPRAALVKSHGGERCGNVGAMIPAGTVERGERKRTVDEVSKAD
Ga0318525_1007132133300032089SoilVADPKPPQAAVVKSDGGERCGNVGAMISAGKIERGERKQTASEASKSD
Ga0318577_1031354223300032091SoilPSHRKLLRLKCRGGERCGNAGTMIPAGKVGRGECKQTVDEVSKAD
Ga0310895_1033859233300032122SoilAVVKSHGRERCGNVGTVIPAGMIERGERKRTASEASKAD
Ga0311301_1178925623300032160Peatlands SoilSRGGERCGNAGTKILAGKVERGERKRTVDEVSKAD
Ga0307472_10010993013300032205Hardwood Forest SoilVRQSGADPKPLQAAAVKSRGGERCSQVWARSPDGKVERGERKQTVDEVSKAD
Ga0307472_10086657613300032205Hardwood Forest SoilRAALVKSHGGERCGNVGTMIPAGTAERGERKRTVDEVSKAD
Ga0316192_1078204513300032260Worm BurrowIDPKPLQAAVVKSDGGERCRNAGTKIPAGTVEGGERKRTTAEASKAD
Ga0316189_1090779423300032272Worm BurrowKSDGGERCRNVGAMTLIGKVKRGERKRTTSEVSKAD
Ga0316189_1107849413300032272Worm BurrowQAAVVKSDGGERCRNAGTKIPAGTVEGGERKRTTAEASKAD
Ga0316189_1122461313300032272Worm BurrowPQTAVVKSDGGERCGNAGAMIPAGKVERGERKRTTAEVS
Ga0335085_1128811013300032770SoilKPPQAAVVKSDGGERCGNVGAMISAGKIERGERKQTASEASKSD
Ga0335069_1048467223300032893SoilAAVVKSDGGERCGNVGTMIPAGKIERGERKQTVDDVSKAV
Ga0318519_1049821113300033290SoilRKLLRLKCRGGERCGNAGTMIPAGKVGRGECKQTVDEVSKAD
Ga0299912_1087565123300033489SoilQAAVVKSNGGERCGNAGTMIPAGTVERGERKRTADEVSKAD
Ga0314781_085282_504_6143300034660SoilKSDGGERCGKVGATIPAGKVERGERKRIVDEVSKAD


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.