NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F019056

Metagenome / Metatranscriptome Family F019056

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F019056
Family Type Metagenome / Metatranscriptome
Number of Sequences 232
Average Sequence Length 38 residues
Representative Sequence IAEWPAPGSEDTELGVLMEPEVGHGETEVYARVQA
Number of Associated Samples 207
Number of Associated Scaffolds 232

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 6.93 %
% of genes near scaffold ends (potentially truncated) 96.98 %
% of genes from short scaffolds (< 2000 bps) 87.50 %
Associated GOLD sequencing projects 202
AlphaFold2 3D model prediction Yes
3D model pTM-score0.14

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (88.793 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil
(25.000 % of family members)
Environment Ontology (ENVO) Unclassified
(21.983 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Soil (non-saline)
(40.948 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 0.00%    β-sheet: 0.00%    Coil/Unstructured: 100.00%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.14
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 232 Family Scaffolds
PF01527HTH_Tnp_1 43.53
PF13333rve_2 19.40
PF13276HTH_21 12.93
PF02371Transposase_20 0.86
PF02518HATPase_c 0.86
PF01548DEDD_Tnp_IS110 0.86
PF04392ABC_sub_bind 0.43
PF14022DUF4238 0.43
PF05598DUF772 0.43
PF13579Glyco_trans_4_4 0.43
PF00118Cpn60_TCP1 0.43
PF00665rve 0.43
PF13289SIR2_2 0.43
PF13274DUF4065 0.43
PF07719TPR_2 0.43
PF13683rve_3 0.43
PF07883Cupin_2 0.43
PF01476LysM 0.43
PF12833HTH_18 0.43
PF13772AIG2_2 0.43

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 232 Family Scaffolds
COG3547TransposaseMobilome: prophages, transposons [X] 1.72
COG0459Chaperonin GroEL (HSP60 family)Posttranslational modification, protein turnover, chaperones [O] 0.43
COG2801Transposase InsO and inactivated derivativesMobilome: prophages, transposons [X] 0.43
COG2826Transposase and inactivated derivatives, IS30 familyMobilome: prophages, transposons [X] 0.43
COG2984ABC-type uncharacterized transport system, periplasmic componentGeneral function prediction only [R] 0.43
COG3316Transposase (or an inactivated derivative), DDE domainMobilome: prophages, transposons [X] 0.43
COG4584TransposaseMobilome: prophages, transposons [X] 0.43


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms88.79 %
UnclassifiedrootN/A11.21 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000363|ICChiseqgaiiFebDRAFT_10943056All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria635Open in IMG/M
3300000787|JGI11643J11755_11389787All Organisms → cellular organisms → Bacteria562Open in IMG/M
3300000858|JGI10213J12805_10010893All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae697Open in IMG/M
3300001176|JGI12655J13551_102471All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Nitrobacter → unclassified Nitrobacter → Nitrobacter sp.521Open in IMG/M
3300001239|Draft_10455323All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium4642Open in IMG/M
3300001447|JGI12529J15002_10043All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Nitrobacter → unclassified Nitrobacter → Nitrobacter sp.617Open in IMG/M
3300001593|JGI12635J15846_10287959Not Available1034Open in IMG/M
3300003372|JGI26336J50218_1003348All Organisms → cellular organisms → Bacteria989Open in IMG/M
3300005332|Ga0066388_103438902Not Available808Open in IMG/M
3300005332|Ga0066388_108637562Not Available506Open in IMG/M
3300005471|Ga0070698_101096415Not Available745Open in IMG/M
3300005610|Ga0070763_10039025All Organisms → cellular organisms → Bacteria2211Open in IMG/M
3300005764|Ga0066903_100664165All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Bacilli → Bacillales → Paenibacillaceae → Paenibacillus → Paenibacillus silvae1826Open in IMG/M
3300006034|Ga0066656_10741670Not Available630Open in IMG/M
3300006055|Ga0097691_1019213All Organisms → cellular organisms → Bacteria → Acidobacteria → unclassified Acidobacteria → Acidobacteria bacterium3005Open in IMG/M
3300006102|Ga0075015_100206920All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1047Open in IMG/M
3300006580|Ga0074049_12975125Not Available582Open in IMG/M
3300006606|Ga0074062_13026408Not Available593Open in IMG/M
3300007258|Ga0099793_10719592All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium503Open in IMG/M
3300009012|Ga0066710_100214263All Organisms → cellular organisms → Bacteria → Proteobacteria2755Open in IMG/M
3300009174|Ga0105241_12044665All Organisms → cellular organisms → Bacteria565Open in IMG/M
3300009525|Ga0116220_10119587All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1122Open in IMG/M
3300009665|Ga0116135_1336584Not Available602Open in IMG/M
3300009789|Ga0126307_11375027All Organisms → cellular organisms → Bacteria572Open in IMG/M
3300010373|Ga0134128_12084784All Organisms → cellular organisms → Bacteria624Open in IMG/M
3300012198|Ga0137364_10359885Not Available1086Open in IMG/M
3300012199|Ga0137383_10729086All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria724Open in IMG/M
3300012201|Ga0137365_10529134Not Available866Open in IMG/M
3300012205|Ga0137362_10062561All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria3062Open in IMG/M
3300012208|Ga0137376_10601674All Organisms → cellular organisms → Bacteria951Open in IMG/M
3300012208|Ga0137376_11699616Not Available522Open in IMG/M
3300012929|Ga0137404_10618435All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria975Open in IMG/M
3300012989|Ga0164305_12136369Not Available514Open in IMG/M
3300014654|Ga0181525_10321055All Organisms → cellular organisms → Bacteria847Open in IMG/M
3300014969|Ga0157376_10644501All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1059Open in IMG/M
3300016294|Ga0182041_12041580Not Available534Open in IMG/M
3300016319|Ga0182033_11491153Not Available610Open in IMG/M
3300016319|Ga0182033_11795938All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium556Open in IMG/M
3300016341|Ga0182035_11322848Not Available646Open in IMG/M
3300016371|Ga0182034_10073961All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium2349Open in IMG/M
3300016371|Ga0182034_10898269Not Available762Open in IMG/M
3300017939|Ga0187775_10393539All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.571Open in IMG/M
3300017973|Ga0187780_11184064All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium560Open in IMG/M
3300018073|Ga0184624_10174983All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → Bradyrhizobium lablabi951Open in IMG/M
3300018432|Ga0190275_10015029All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae5854Open in IMG/M
3300019789|Ga0137408_1136445All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria691Open in IMG/M
3300019789|Ga0137408_1168086All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1214Open in IMG/M
3300019789|Ga0137408_1245531All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria1566Open in IMG/M
3300019789|Ga0137408_1294576All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2203Open in IMG/M
3300019789|Ga0137408_1294577All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2164Open in IMG/M
3300019869|Ga0193705_1024525All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1307Open in IMG/M
3300019884|Ga0193741_1036094All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1276Open in IMG/M
3300019889|Ga0193743_1199777All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium636Open in IMG/M
3300019997|Ga0193711_1008600All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1285Open in IMG/M
3300019999|Ga0193718_1027034All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1275Open in IMG/M
3300020002|Ga0193730_1044225All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1288Open in IMG/M
3300020002|Ga0193730_1044950All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1277Open in IMG/M
3300020016|Ga0193696_1062482All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium975Open in IMG/M
3300020193|Ga0194131_10382508All Organisms → cellular organisms → Bacteria632Open in IMG/M
3300020582|Ga0210395_10185784All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1557Open in IMG/M
3300020582|Ga0210395_10909966All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae653Open in IMG/M
3300021178|Ga0210408_10262417All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1376Open in IMG/M
3300021181|Ga0210388_10358237All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1282Open in IMG/M
3300021339|Ga0193706_1043941All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1272Open in IMG/M
3300021363|Ga0193699_10082449All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1283Open in IMG/M
3300021405|Ga0210387_10300258All Organisms → cellular organisms → Bacteria → Proteobacteria1412Open in IMG/M
3300021405|Ga0210387_11256460All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium641Open in IMG/M
3300021407|Ga0210383_10407367All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1173Open in IMG/M
3300021432|Ga0210384_10373319All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1284Open in IMG/M
3300021474|Ga0210390_10291053All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae1383Open in IMG/M
3300021474|Ga0210390_10552962All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium967Open in IMG/M
3300021476|Ga0187846_10329349All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae630Open in IMG/M
3300021479|Ga0210410_10154878All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae2043Open in IMG/M
3300021951|Ga0222624_1421032All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium728Open in IMG/M
3300022557|Ga0212123_10622166All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium677Open in IMG/M
3300022563|Ga0212128_10401995All Organisms → cellular organisms → Bacteria → Nitrospirae → Nitrospira → Nitrospirales → Nitrospiraceae → Nitrospira → unclassified Nitrospira → Nitrospira sp.848Open in IMG/M
3300022694|Ga0222623_10065884All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1399Open in IMG/M
3300022708|Ga0242670_1038646All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium643Open in IMG/M
3300022737|Ga0247747_1047919All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae531Open in IMG/M
3300022898|Ga0247745_1009766All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1281Open in IMG/M
3300022901|Ga0247788_1015915All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1291Open in IMG/M
3300023071|Ga0247752_1038069All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.729Open in IMG/M
3300024433|Ga0209986_10136676All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1285Open in IMG/M
3300025167|Ga0209642_10698140All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium542Open in IMG/M
3300025457|Ga0208850_1076672All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp.538Open in IMG/M
3300025612|Ga0208691_1136443All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium553Open in IMG/M
3300025627|Ga0208220_1040559All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1403Open in IMG/M
3300025898|Ga0207692_10169056All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1266Open in IMG/M
3300025911|Ga0207654_11233694All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium545Open in IMG/M
3300025916|Ga0207663_10414842All Organisms → cellular organisms → Bacteria → Proteobacteria1032Open in IMG/M
3300025918|Ga0207662_11085634All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae569Open in IMG/M
3300025921|Ga0207652_10476539All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Xanthobacteraceae → Pseudolabrys → Pseudolabrys taiwanensis1124Open in IMG/M
3300025932|Ga0207690_10513436All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium970Open in IMG/M
3300025935|Ga0207709_11106427All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae651Open in IMG/M
3300025937|Ga0207669_10230662All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1365Open in IMG/M
3300025938|Ga0207704_11205081All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium646Open in IMG/M
3300025939|Ga0207665_10297411All Organisms → cellular organisms → Bacteria → Proteobacteria1206Open in IMG/M
3300025960|Ga0207651_10329779All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1278Open in IMG/M
3300025972|Ga0207668_11125530All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium704Open in IMG/M
3300026095|Ga0207676_10364298All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1340Open in IMG/M
3300026121|Ga0207683_10504030All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1118Open in IMG/M
3300026316|Ga0209155_1127756All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium876Open in IMG/M
3300026327|Ga0209266_1237729All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium598Open in IMG/M
3300026355|Ga0257149_1041170All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium660Open in IMG/M
3300026475|Ga0257147_1006626All Organisms → cellular organisms → Bacteria1458Open in IMG/M
3300026475|Ga0257147_1009525All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1271Open in IMG/M
3300026475|Ga0257147_1013949All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1086Open in IMG/M
3300026489|Ga0257160_1009122Not Available1381Open in IMG/M
3300026490|Ga0257153_1022979All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1280Open in IMG/M
3300026494|Ga0257159_1014223All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1268Open in IMG/M
3300026523|Ga0209808_1080662All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1404Open in IMG/M
3300026889|Ga0207745_1000918Not Available4174Open in IMG/M
3300027031|Ga0208986_1007698All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1001Open in IMG/M
3300027070|Ga0208365_1042894All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae604Open in IMG/M
3300027090|Ga0208604_1024972All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria565Open in IMG/M
3300027424|Ga0209984_1065661All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium539Open in IMG/M
3300027496|Ga0208987_1008699All Organisms → cellular organisms → Bacteria → Proteobacteria1665Open in IMG/M
3300027524|Ga0208998_1051853All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium669Open in IMG/M
3300027567|Ga0209115_1032029All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1190Open in IMG/M
3300027583|Ga0209527_1058072All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium872Open in IMG/M
3300027643|Ga0209076_1048215All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium1205Open in IMG/M
3300027676|Ga0209333_1148719All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium630Open in IMG/M
3300027843|Ga0209798_10125492All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1296Open in IMG/M
3300027854|Ga0209517_10345956Not Available853Open in IMG/M
3300027873|Ga0209814_10155372All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium982Open in IMG/M
3300027879|Ga0209169_10118917Not Available1370Open in IMG/M
3300027880|Ga0209481_10345682All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium758Open in IMG/M
3300027895|Ga0209624_10071388All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2240Open in IMG/M
3300027903|Ga0209488_10111075All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2059Open in IMG/M
3300027905|Ga0209415_10732073All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium702Open in IMG/M
3300027909|Ga0209382_10297899All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1819Open in IMG/M
3300027909|Ga0209382_10770351All Organisms → cellular organisms → Bacteria1027Open in IMG/M
3300027979|Ga0209705_10146385All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1266Open in IMG/M
3300028023|Ga0265357_1000477All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae2341Open in IMG/M
3300028381|Ga0268264_11585948All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium665Open in IMG/M
3300028679|Ga0302169_10065127All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium856Open in IMG/M
3300028712|Ga0307285_10006965All Organisms → cellular organisms → Bacteria2344Open in IMG/M
3300028714|Ga0307309_10020318All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1285Open in IMG/M
3300028717|Ga0307298_10164672All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium647Open in IMG/M
3300028719|Ga0307301_10050755All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1276Open in IMG/M
3300028747|Ga0302219_10074876All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1269Open in IMG/M
3300028771|Ga0307320_10434147All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae528Open in IMG/M
3300028774|Ga0302208_10189897All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium507Open in IMG/M
3300028791|Ga0307290_10070254All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1270Open in IMG/M
3300028798|Ga0302222_10087001All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1249Open in IMG/M
3300028809|Ga0247824_10695407All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae619Open in IMG/M
3300028824|Ga0307310_10512002All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium605Open in IMG/M
3300028863|Ga0302218_10055493All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1243Open in IMG/M
3300028906|Ga0308309_11259693All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium636Open in IMG/M
3300029910|Ga0311369_10121081All Organisms → cellular organisms → Bacteria2585Open in IMG/M
3300029943|Ga0311340_10477808All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1120Open in IMG/M
3300029943|Ga0311340_10972772All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium699Open in IMG/M
3300029952|Ga0311346_10597459All Organisms → cellular organisms → Bacteria → Proteobacteria990Open in IMG/M
3300030007|Ga0311338_11059409All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria782Open in IMG/M
3300030707|Ga0310038_10403749All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium → unclassified Bradyrhizobium → Bradyrhizobium sp. Tv2a-2594Open in IMG/M
3300030739|Ga0302311_10257710All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1288Open in IMG/M
3300030851|Ga0075380_11121024All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium548Open in IMG/M
3300031028|Ga0302180_10030071All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales3405Open in IMG/M
3300031152|Ga0307501_10111685All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium703Open in IMG/M
3300031199|Ga0307495_10008910All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1415Open in IMG/M
3300031226|Ga0307497_10132079All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1015Open in IMG/M
3300031241|Ga0265325_10094390All Organisms → cellular organisms → Bacteria1471Open in IMG/M
3300031242|Ga0265329_10072426All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1090Open in IMG/M
3300031249|Ga0265339_10130631All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1284Open in IMG/M
3300031360|Ga0307444_1103752All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium875Open in IMG/M
3300031366|Ga0307506_10018415All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1697Open in IMG/M
3300031474|Ga0170818_102388497All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium778Open in IMG/M
3300031525|Ga0302326_10876702All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1280Open in IMG/M
3300031525|Ga0302326_12410501All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium663Open in IMG/M
3300031544|Ga0318534_10032963All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2837Open in IMG/M
3300031546|Ga0318538_10019623All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales2991Open in IMG/M
3300031561|Ga0318528_10025361All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2874Open in IMG/M
3300031564|Ga0318573_10128457All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1318Open in IMG/M
3300031572|Ga0318515_10021292All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae3065Open in IMG/M
3300031653|Ga0315550_1077909All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1463Open in IMG/M
3300031682|Ga0318560_10445028All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae701Open in IMG/M
3300031711|Ga0265314_10179007All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1272Open in IMG/M
3300031711|Ga0265314_10179841All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1268Open in IMG/M
3300031712|Ga0265342_10159281All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1248Open in IMG/M
3300031713|Ga0318496_10132402All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1353Open in IMG/M
3300031719|Ga0306917_11545735Not Available510Open in IMG/M
3300031736|Ga0318501_10125349All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1303Open in IMG/M
3300031740|Ga0307468_100307330All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1155Open in IMG/M
3300031744|Ga0306918_10177951All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1590Open in IMG/M
3300031748|Ga0318492_10118897All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1312Open in IMG/M
3300031751|Ga0318494_10637223All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium623Open in IMG/M
3300031763|Ga0318537_10070038All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1284Open in IMG/M
3300031778|Ga0318498_10100406All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1311Open in IMG/M
3300031782|Ga0318552_10018213All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria3070Open in IMG/M
3300031792|Ga0318529_10095077All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1340Open in IMG/M
3300031805|Ga0318497_10151412All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1269Open in IMG/M
3300031820|Ga0307473_10148420All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1329Open in IMG/M
3300031821|Ga0318567_10149622All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1290Open in IMG/M
3300031832|Ga0318499_10065387All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1375Open in IMG/M
3300031833|Ga0310917_10152925All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1523Open in IMG/M
3300031833|Ga0310917_10763598Not Available653Open in IMG/M
3300031845|Ga0318511_10088456All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1303Open in IMG/M
3300031846|Ga0318512_10023218All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2586Open in IMG/M
3300031859|Ga0318527_10076313All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1350Open in IMG/M
3300031890|Ga0306925_10029119All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria5609Open in IMG/M
3300031890|Ga0306925_10259988All Organisms → cellular organisms → Bacteria1870Open in IMG/M
3300031893|Ga0318536_10131421All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1267Open in IMG/M
3300031896|Ga0318551_10081741All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1692Open in IMG/M
3300031897|Ga0318520_10030217Not Available2699Open in IMG/M
3300031912|Ga0306921_10556783All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1329Open in IMG/M
3300031912|Ga0306921_12000750All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium617Open in IMG/M
3300031912|Ga0306921_12594371Not Available523Open in IMG/M
3300031945|Ga0310913_10187424All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1442Open in IMG/M
3300031946|Ga0310910_11587430All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium500Open in IMG/M
3300031981|Ga0318531_10016656All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2872Open in IMG/M
3300032009|Ga0318563_10069853All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1824Open in IMG/M
3300032010|Ga0318569_10016530All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2898Open in IMG/M
3300032013|Ga0310906_10767377All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium679Open in IMG/M
3300032041|Ga0318549_10098123All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1274Open in IMG/M
3300032061|Ga0315540_10124514All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1166Open in IMG/M
3300032064|Ga0318510_10344276All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium627Open in IMG/M
3300032089|Ga0318525_10133170All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1273Open in IMG/M
3300032089|Ga0318525_10720593All Organisms → cellular organisms → Bacteria507Open in IMG/M
3300032090|Ga0318518_10019717All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria2957Open in IMG/M
3300032180|Ga0307471_100598280All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1261Open in IMG/M
3300032180|Ga0307471_100716905All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1165Open in IMG/M
3300033004|Ga0335084_10474509All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1286Open in IMG/M
3300033158|Ga0335077_10497828All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1289Open in IMG/M
3300033290|Ga0318519_10355022All Organisms → cellular organisms → Bacteria867Open in IMG/M
3300033290|Ga0318519_10918437Not Available541Open in IMG/M
3300033412|Ga0310810_10463106All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae1278Open in IMG/M
3300033475|Ga0310811_10479065All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1315Open in IMG/M
3300033513|Ga0316628_100743985All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1289Open in IMG/M
3300034115|Ga0364945_0040863All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales1274Open in IMG/M
3300034124|Ga0370483_0074907All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1093Open in IMG/M
3300034195|Ga0370501_0050562All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → Hyphomicrobiales → Bradyrhizobiaceae → Bradyrhizobium1320Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil25.00%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil10.78%
Vadose Zone SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Vadose Zone Soil6.47%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil5.60%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil4.74%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa4.74%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere3.02%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Soil2.59%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil1.72%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural Land → Soil1.72%
Hardwood Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Hardwood Forest Soil1.72%
Tropical Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Tropical Forest Soil1.72%
Corn, Switchgrass And Miscanthus RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn, Switchgrass And Miscanthus Rhizosphere1.72%
Populus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Populus Rhizosphere1.72%
Arctic Peat SoilEnvironmental → Terrestrial → Soil → Unclassified → Permafrost → Arctic Peat Soil1.29%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil1.29%
SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Soil1.29%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Peatland0.86%
Salt Marsh SedimentEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh Sediment0.86%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.86%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.86%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil0.86%
Tropical PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Tropical Peatland0.86%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen0.86%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.86%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.86%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere0.86%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment0.43%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment0.43%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake0.43%
Bog Forest SoilEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog Forest Soil0.43%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog0.43%
Wetland SedimentEnvironmental → Aquatic → Freshwater → Wetlands → Unclassified → Wetland Sediment0.43%
Deep SubsurfaceEnvironmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface0.43%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh0.43%
Thermal SpringsEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Unclassified → Thermal Springs0.43%
Iron-Sulfur Acid SpringEnvironmental → Aquatic → Thermal Springs → Hot (42-90C) → Acidic → Iron-Sulfur Acid Spring0.43%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.43%
WatershedsEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Watersheds0.43%
Groundwater SedimentEnvironmental → Aquatic → Sediment → Unclassified → Unclassified → Groundwater Sediment0.43%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.43%
Serpentine SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Serpentine Soil0.43%
Grasslands SoilEnvironmental → Terrestrial → Soil → Unclassified → Grasslands → Grasslands Soil0.43%
Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Forest Soil0.43%
SoilEnvironmental → Terrestrial → Soil → Loam → Grasslands → Soil0.43%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil0.43%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.43%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.43%
SoilEnvironmental → Terrestrial → Soil → Loam → Unclassified → Soil0.43%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog0.43%
BiofilmEnvironmental → Terrestrial → Cave → Unclassified → Unclassified → Biofilm0.43%
SedimentEnvironmental → Terrestrial → Floodplain → Sediment → Unclassified → Sediment0.43%
Arabidopsis Thaliana RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Thaliana Rhizosphere0.43%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere0.43%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere0.43%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.43%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.43%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Miscanthus Rhizosphere0.43%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere0.43%
Hydrocarbon Resource EnvironmentsEngineered → Wastewater → Industrial Wastewater → Petrochemical → Unclassified → Hydrocarbon Resource Environments0.43%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000363Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000787Soil microbial communities from Great Prairies - Iowa, Continuous Corn soilEnvironmentalOpen in IMG/M
3300000858Soil microbial communities from Great Prairies - Wisconsin Native Prairie soilEnvironmentalOpen in IMG/M
3300001176Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM1_O2EnvironmentalOpen in IMG/M
3300001239Tailings pond microbial communities from Northern Alberta - Syncrude Mildred Lake Settling BasinEngineeredOpen in IMG/M
3300001447Forest soil microbial communities from Browns Valley, California, USA, that are Nitrogen fertilized - NN95EnvironmentalOpen in IMG/M
3300001593Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_M2EnvironmentalOpen in IMG/M
3300003372Bog forest soil microbial communities from Calvert Island, British Columbia, Canada - ECP03_OM1EnvironmentalOpen in IMG/M
3300005332Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 6 (Hybrid Assembly)EnvironmentalOpen in IMG/M
3300005471Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaGEnvironmentalOpen in IMG/M
3300005610Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 3EnvironmentalOpen in IMG/M
3300005764Tropical forest soil microbial communities from Panama analyzed to predict greenhouse gas emissions - Panama Soil - Plot 1 (version 2)EnvironmentalOpen in IMG/M
3300006034Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_105EnvironmentalOpen in IMG/M
3300006055Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-1 deep-072012EnvironmentalOpen in IMG/M
3300006102Freshwater sediment microbial communities in response to fracking from Pennsylvania, USA - Alex Branch Run_MetaG_ABR_2013EnvironmentalOpen in IMG/M
3300006580Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtLPC (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006606Soil and rhizosphere microbial communities from Centre INRS-Institut Armand-Frappier, Laval, Canada - Soil microcosm metaTmtHMA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300007258Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3EnvironmentalOpen in IMG/M
3300009012Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_159EnvironmentalOpen in IMG/M
3300009174Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaGHost-AssociatedOpen in IMG/M
3300009525Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_7_NC metaGEnvironmentalOpen in IMG/M
3300009665Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10EnvironmentalOpen in IMG/M
3300009789Serpentine soil microbial communities from UC McLaughlin Reserve, CA, USA - Plot28EnvironmentalOpen in IMG/M
3300010373Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-4EnvironmentalOpen in IMG/M
3300012198Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012199Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_R_40_16 metaGEnvironmentalOpen in IMG/M
3300012201Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage1_L_40_16 metaGEnvironmentalOpen in IMG/M
3300012205Vadose zone soil microbial communities from Angelo Coast Range Reserve, California, USA - Mad1_100_16 metaGEnvironmentalOpen in IMG/M
3300012208Vadose zone soil microbial communities from Sagehorn Ranch, Mendocino, California, USA - Sage2_L_20_16 metaGEnvironmentalOpen in IMG/M
3300012929Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_1_16fungal (Illumina Assembly)EnvironmentalOpen in IMG/M
3300012989Soil microbial communities amended with pyrogenic organic matter from upstate New York, USA - Whitman soil sample_237_MGEnvironmentalOpen in IMG/M
3300014654Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_10_metaGEnvironmentalOpen in IMG/M
3300014969Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaGHost-AssociatedOpen in IMG/M
3300016294Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.178EnvironmentalOpen in IMG/M
3300016319Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00HEnvironmentalOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300016371Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.172EnvironmentalOpen in IMG/M
3300017939Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP12_10_MGEnvironmentalOpen in IMG/M
3300017973Tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 1015_Q2_SP10_20_MGEnvironmentalOpen in IMG/M
3300018073Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM3_5_b1EnvironmentalOpen in IMG/M
3300018432Populus adjacent soil microbial communities from riparian zone of Yellowstone River, Montana, USA - 550 TEnvironmentalOpen in IMG/M
3300019789Vadose zone soil fungal communities from Angelo Coast Range Reserve, California, USA - CZOMad2_2_16fungal (PacBio error correction)EnvironmentalOpen in IMG/M
3300019869Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3m2EnvironmentalOpen in IMG/M
3300019884Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2s2EnvironmentalOpen in IMG/M
3300019889Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L2c2EnvironmentalOpen in IMG/M
3300019997Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? H3m2EnvironmentalOpen in IMG/M
3300019999Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U2a1EnvironmentalOpen in IMG/M
3300020002Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U1a1EnvironmentalOpen in IMG/M
3300020016Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3m1EnvironmentalOpen in IMG/M
3300020193Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015053 Kigoma Offshore 120mEnvironmentalOpen in IMG/M
3300020579Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-27-MEnvironmentalOpen in IMG/M
3300020582Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-OEnvironmentalOpen in IMG/M
3300021178Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-MEnvironmentalOpen in IMG/M
3300021181Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-19-OEnvironmentalOpen in IMG/M
3300021339Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? U3c1EnvironmentalOpen in IMG/M
3300021363Soil microbial communities from a riparian zone of the East river system, Colorado, United States ? L3c2EnvironmentalOpen in IMG/M
3300021405Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-OEnvironmentalOpen in IMG/M
3300021407Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-14-OEnvironmentalOpen in IMG/M
3300021432Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-MEnvironmentalOpen in IMG/M
3300021474Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-11-OEnvironmentalOpen in IMG/M
3300021476Biofilm microbial communities from the roof of an iron ore cave, State of Minas Gerais, Brazil - TC_06 Biofilm (v2)EnvironmentalOpen in IMG/M
3300021479Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-4-MEnvironmentalOpen in IMG/M
3300021951Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022557Paint Pots_combined assemblyEnvironmentalOpen in IMG/M
3300022563OV2_combined assemblyEnvironmentalOpen in IMG/M
3300022694Groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM2_30_coexEnvironmentalOpen in IMG/M
3300022708Metatranscriptome of lab incubated forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-30-O (Metagenome Metatranscriptome) (v2)EnvironmentalOpen in IMG/M
3300022737Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S094-311B-5EnvironmentalOpen in IMG/M
3300022898Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S109-311C-5EnvironmentalOpen in IMG/M
3300022901Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S156-409C-4EnvironmentalOpen in IMG/M
3300023071Soil microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-S019-104C-5EnvironmentalOpen in IMG/M
3300024433Deep subsurface microbial communities from Black Sea to uncover new lineages of life (NeLLi) - Black_00105 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025167Soil microbial communities from Rifle, Colorado - Rifle CSP2_sed 19_2 (SPAdes)EnvironmentalOpen in IMG/M
3300025457Arctic peat soil from Barrow, Alaska - NGEE Surface sample 210-2 shallow-092012 (SPAdes)EnvironmentalOpen in IMG/M
3300025612Peatland microbial communities from Minnesota, USA, analyzing carbon cycling and trace gas fluxes - June2015DPH_20_10 (SPAdes)EnvironmentalOpen in IMG/M
3300025627Arctic peat soil from Barrow, Alaska - NGEE Surface sample F53-1 deep-092012 (SPAdes)EnvironmentalOpen in IMG/M
3300025898Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025911Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025916Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025918Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025921Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025932Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025935Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025937Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025938Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025939Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025960Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025972Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026095Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026121Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026316Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_122 (SPAdes)EnvironmentalOpen in IMG/M
3300026327Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_132 (SPAdes)EnvironmentalOpen in IMG/M
3300026355Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DL-02-AEnvironmentalOpen in IMG/M
3300026475Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - CO-12-AEnvironmentalOpen in IMG/M
3300026489Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-11-AEnvironmentalOpen in IMG/M
3300026490Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - DW-10-AEnvironmentalOpen in IMG/M
3300026494Soil microbial communities from H.J. Andrews Experimental Forest, Oregon, United States - NL-07-AEnvironmentalOpen in IMG/M
3300026523Grasslands soil microbial communities from the Angelo Coastal Reserve, California, USA - Sample Angelo_157 (SPAdes)EnvironmentalOpen in IMG/M
3300026889Tropical forest soil microbial communities from Luquillo Experimental Forest, Puerto Rico - Sample 57 (SPAdes)EnvironmentalOpen in IMG/M
3300027031Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM1_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300027070Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF004 (SPAdes)EnvironmentalOpen in IMG/M
3300027090Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF016 (SPAdes)EnvironmentalOpen in IMG/M
3300027424Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes)Host-AssociatedOpen in IMG/M
3300027496Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA Ref_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300027524Forest soil microbial communities from El Dorado National Forest, California, USA - Mediterranean Blodgett CA OM2_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027567Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O2 (SPAdes)EnvironmentalOpen in IMG/M
3300027583Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_M2 (SPAdes)EnvironmentalOpen in IMG/M
3300027643Vadose zone soil and rhizosphere microbial communities from the Eel River Critical Zone Observatory, Northern California to study diel carbon cycling - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_3 (SPAdes)EnvironmentalOpen in IMG/M
3300027676Forest soil microbial communities from Thunder Bay, Ontario, Canada - Black Spruce, Ontario site 2_A8_OM2_O3 (SPAdes)EnvironmentalOpen in IMG/M
3300027843Wetland sediment microbial communities from St. Louis River estuary, USA, under dissolved organic matter induced mercury methylation - T4Bare3Fresh (SPAdes)EnvironmentalOpen in IMG/M
3300027854Peat soil microbial communities from Weissenstadt, Germany - SII-2010 (SPAdes)EnvironmentalOpen in IMG/M
3300027873Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD1 (SPAdes)Host-AssociatedOpen in IMG/M
3300027879Warmed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WRM 4 (SPAdes)EnvironmentalOpen in IMG/M
3300027880Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD3 (SPAdes)Host-AssociatedOpen in IMG/M
3300027895Forest soil microbial communities from Algoma, Ontario, Canada - Jack Pine, Ontario site 1_JW_OM2H0_O1 (SPAdes)EnvironmentalOpen in IMG/M
3300027903Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Bulk_2 (SPAdes)EnvironmentalOpen in IMG/M
3300027905Peat soil microbial communities from Weissenstadt, Germany - SII-SIP-2007 (SPAdes)EnvironmentalOpen in IMG/M
3300027909Populus root and rhizosphere microbial communities from Tennessee, USA - Soil MetaG P. deltoides SBSDD5 (SPAdes)Host-AssociatedOpen in IMG/M
3300027979Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P8 Core (1) Depth 10-12cm September2015 (SPAdes)EnvironmentalOpen in IMG/M
3300028023Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5Host-AssociatedOpen in IMG/M
3300028381Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300028679Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_N1_3EnvironmentalOpen in IMG/M
3300028712Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_139EnvironmentalOpen in IMG/M
3300028714Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_196EnvironmentalOpen in IMG/M
3300028717Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_158EnvironmentalOpen in IMG/M
3300028719Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_182EnvironmentalOpen in IMG/M
3300028747Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_2EnvironmentalOpen in IMG/M
3300028771Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_369EnvironmentalOpen in IMG/M
3300028774Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_E2_3EnvironmentalOpen in IMG/M
3300028791Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_144EnvironmentalOpen in IMG/M
3300028798Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E2_2EnvironmentalOpen in IMG/M
3300028809Soil microbial communities from agricultural site in Penn Yan, New York, United States - 13C_PalmiticAcid_Day48EnvironmentalOpen in IMG/M
3300028824Soil microbial communities from the East River watershed near Crested Butte, Colorado, United States - ER_DNA_197EnvironmentalOpen in IMG/M
3300028863Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_E1_1EnvironmentalOpen in IMG/M
3300028906Warmed and freeze-thawed soil microbial communities from the Hubbard Brook experimental Forest, New Hampshire - Hubbard Brook CCASE Soil Metagenome WFT 5 (v2)EnvironmentalOpen in IMG/M
3300029910III_Palsa_E2 coassemblyEnvironmentalOpen in IMG/M
3300029943I_Palsa_N3 coassemblyEnvironmentalOpen in IMG/M
3300029952II_Bog_N3 coassemblyEnvironmentalOpen in IMG/M
3300030007I_Palsa_E1 coassemblyEnvironmentalOpen in IMG/M
3300030707Peat soil microbial communities from Weissenstadt, Germany - Sb_50d_4_PS metaG (v2)EnvironmentalOpen in IMG/M
3300030739Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Palsa_N1_3EnvironmentalOpen in IMG/M
3300030851Forest soil microbial communities from France for metatranscriptomics studies - Site 11 - Champenoux / Amance forest - OA9 SO (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300031028Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Palsa_E3_2EnvironmentalOpen in IMG/M
3300031152Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 15_SEnvironmentalOpen in IMG/M
3300031199Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 7_SEnvironmentalOpen in IMG/M
3300031226Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 10_SEnvironmentalOpen in IMG/M
3300031241Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaGHost-AssociatedOpen in IMG/M
3300031242Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaGHost-AssociatedOpen in IMG/M
3300031249Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaGHost-AssociatedOpen in IMG/M
3300031360Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - SW1603-40EnvironmentalOpen in IMG/M
3300031366Soil microbial communities from Populus trichocarpa stands in riparian zone in the Pacific Northwest, United States - 25_SEnvironmentalOpen in IMG/M
3300031474Fir Coassembly Site 11 - Champenoux / Amance forestEnvironmentalOpen in IMG/M
3300031525Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Palsa_T0_3EnvironmentalOpen in IMG/M
3300031544Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f26EnvironmentalOpen in IMG/M
3300031546Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.166b4f23EnvironmentalOpen in IMG/M
3300031561Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f26EnvironmentalOpen in IMG/M
3300031564Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.089b5f21EnvironmentalOpen in IMG/M
3300031572Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f19EnvironmentalOpen in IMG/M
3300031653Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1601-90EnvironmentalOpen in IMG/M
3300031682Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.065b5f22EnvironmentalOpen in IMG/M
3300031711Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaGHost-AssociatedOpen in IMG/M
3300031712Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaGHost-AssociatedOpen in IMG/M
3300031713Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f22EnvironmentalOpen in IMG/M
3300031719Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.000 (v2)EnvironmentalOpen in IMG/M
3300031736Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f21EnvironmentalOpen in IMG/M
3300031740Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gases AM2C_05EnvironmentalOpen in IMG/M
3300031744Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - timezero.00C.oxic.00.000.00H (v2)EnvironmentalOpen in IMG/M
3300031748Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f22EnvironmentalOpen in IMG/M
3300031751Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.108b1f24EnvironmentalOpen in IMG/M
3300031763Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f29EnvironmentalOpen in IMG/M
3300031778Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f24EnvironmentalOpen in IMG/M
3300031782Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f20EnvironmentalOpen in IMG/M
3300031792Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f23EnvironmentalOpen in IMG/M
3300031805Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f23EnvironmentalOpen in IMG/M
3300031820Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM5C_515EnvironmentalOpen in IMG/M
3300031821Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f20EnvironmentalOpen in IMG/M
3300031832Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.109b1f25EnvironmentalOpen in IMG/M
3300031833Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.LF178EnvironmentalOpen in IMG/M
3300031845Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f18EnvironmentalOpen in IMG/M
3300031846Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f19EnvironmentalOpen in IMG/M
3300031859Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f25EnvironmentalOpen in IMG/M
3300031890Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux8day.12C.oxic.44.000.176 (v2)EnvironmentalOpen in IMG/M
3300031893Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.117b4f28EnvironmentalOpen in IMG/M
3300031896Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.082b2f19EnvironmentalOpen in IMG/M
3300031897Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f16EnvironmentalOpen in IMG/M
3300031912Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - statoxic.12C.oxic.44.000.080 (v2)EnvironmentalOpen in IMG/M
3300031945Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.OX082EnvironmentalOpen in IMG/M
3300031946Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.HF172EnvironmentalOpen in IMG/M
3300031981Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.053b4f25EnvironmentalOpen in IMG/M
3300032009Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.066b5f19EnvironmentalOpen in IMG/M
3300032010Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.088b5f22EnvironmentalOpen in IMG/M
3300032013Lab incubated soil microbial communities from West Virginia University Organic Research Farm, Morgantown, WV, United States - C48D3EnvironmentalOpen in IMG/M
3300032041Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.169b2f22EnvironmentalOpen in IMG/M
3300032061Salt marsh sediment microbial communities from the Plum Island Ecosystem LTER, Massachusetts, United States - Salt Marsh Sediment SW1601-10EnvironmentalOpen in IMG/M
3300032064Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.171b2f17EnvironmentalOpen in IMG/M
3300032089Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.052b4f23EnvironmentalOpen in IMG/M
3300032090Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22EnvironmentalOpen in IMG/M
3300032180Hardwood forest soil microbial communities from Morgan-Monroe State Forest, Indiana, United States - atmos_gasesAM3C_515EnvironmentalOpen in IMG/M
3300033004Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.4EnvironmentalOpen in IMG/M
3300033158Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_3.1EnvironmentalOpen in IMG/M
3300033290Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.178b2f15EnvironmentalOpen in IMG/M
3300033412Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - NCEnvironmentalOpen in IMG/M
3300033475Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YCEnvironmentalOpen in IMG/M
3300033513Wetland soil microbial communities from Old Woman Creek delta, Ohio, United States - OWC_Aug_M2_C1_D5_CEnvironmentalOpen in IMG/M
3300034115Sediment microbial communities from East River floodplain, Colorado, United States - 29_s17EnvironmentalOpen in IMG/M
3300034124Peat soil microbial communities from wetlands in Alaska, United States - Goldstream_06D_14EnvironmentalOpen in IMG/M
3300034195Peat soil microbial communities from wetlands in Alaska, United States - Sheep_creek_fen_01D_17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
ICChiseqgaiiFebDRAFT_1094305613300000363SoilAPGSEDAELDDTELGVLMVPEVRHGEAEVYTRAQA*
JGI11643J11755_1138978723300000787SoilVRTFWPALSSEDTELGVFTGPEVRHGEAEVHARVQA
JGI10213J12805_1001089333300000858SoilAAYVHPVWAAAGSKDTELGVKMEPEVGHGATEIYP*
JGI12655J13551_10247113300001176Forest SoilTEWPAPGSADTELGVLMEPEVSHGEAEVYTRVQA*
Draft_1045532333300001239Hydrocarbon Resource EnvironmentsMSRQGLTARNPVWPAPGFEDTKLGVLMEPEVRHGTSEVYTRVQA*
JGI12529J15002_1004333300001447Forest SoilIKWLRRLEVSDWPAPGSEDTELGVLMELEVRHGAAEVYA*
JGI12635J15846_1028795933300001593Forest SoilMRWYVADGGCNVWPAPGSADTELGVLMDLEVGHGETKIYA
JGI26336J50218_100334813300003372Bog Forest SoilSGPKKITVWPAPGSADTELGVFMGPEVSHGETKVYAGVQA*
Ga0066388_10343890233300005332Tropical Forest SoilMELWPAPGSEDTELGVLMELEVGHGETEVYAGVQA*GCAPDQG
Ga0066388_10863756223300005332Tropical Forest SoilMNRKQRRAAAWPAPGSEDTELGVLMELEVGHGETEVHAGVQA*
Ga0070698_10109641513300005471Corn, Switchgrass And Miscanthus RhizosphereVIGAARGEAQVIWPAPGSEDTELGVLMELEVGHGETEVYA
Ga0070763_1003902513300005610SoilMRSFDWPAPGSADTELGVLMELEVGHGETEVYARVQA
Ga0066903_10066416523300005764Tropical Forest SoilMLEQRPLKIVRWPAPGSEDAELGVLMEPEVGHGETEVYPRVQA*
Ga0066656_1074167023300006034SoilPLIPKLAEWPAPGSKDIELGVKMEPEVGHGATKIYPRVQA*
Ga0097691_101921363300006055Arctic Peat SoilMAGRAKWPAPGSEDTKLGVLMEREVRHGAAEVYAGVQA
Ga0075015_10020692033300006102WatershedsAVWPAPGSEDTELGVLMELEVGQGETKVYAAVQA*
Ga0074049_1297512513300006580SoilMPQLTSRLSIWPAPGFEDTELGVLMELEVGHGETEVY
Ga0074062_1302640813300006606SoilMPNLKGVNWPAPGSEDTELGVLMELEVGHGETEVY
Ga0099793_1071959223300007258Vadose Zone SoilDEPLSDWPAPGSEDTELGVMMEQEVGHGETEIYTRVQA*
Ga0066710_10021426363300009012Grasslands SoilGCLPHWPAPGSEDTELGVLMELEVGRGKTEVHARVQA
Ga0105241_1204466513300009174Corn RhizosphereWPAPGSEDTELGVLMELEVGHGETEVYARVQTLACTRFG*
Ga0116220_1011958713300009525Peatlands SoilAVPRAFEEAMWPAAGSTDTQLGVLMELEVDHGKATVYARVQA*
Ga0116135_133658413300009665PeatlandGVNRWSLWPAPGSGNTDFGVFIGPEVRHGETTFYAGVQA*
Ga0126307_1137502713300009789Serpentine SoilMPLQRRAQTRCWPAPGFEDTELGVFMEPEVGHGEAEV
Ga0134128_1208478423300010373Terrestrial SoilVIAWPAPGSEDTDLGVLMEPGGGGRAKTEVYTRVQA*
Ga0137364_1035988513300012198Vadose Zone SoilMASRAIRWPAPGSEDTELGVLMELEVGHGETEVYPRVQA
Ga0137383_1072908623300012199Vadose Zone SoilLLEPVEAVWPAPGSEDTELGVLMELEVCHGETEAYPRVQA*
Ga0137365_1052913413300012201Vadose Zone SoilRKCTRGGALGLWPAPGSEDTELGVLMELEVGHGETEVYPRVQA*
Ga0137362_1006256113300012205Vadose Zone SoilMDTYQFTPWPAPGSEDTELGVLMEPEVGHGETEVYA
Ga0137376_1060167443300012208Vadose Zone SoilAVWPAPGSEDTELGVLMELEVGHGETEVHAGVQA*
Ga0137376_1169961623300012208Vadose Zone SoilVVALVDTIWSAHGSEDTESGVLMELEVGHGETEVYPRVQ
Ga0137404_1061843513300012929Vadose Zone SoilRPFWPAPGSEDTELGVLMELEVCHGETEVYPRVQA*
Ga0164305_1213636913300012989SoilMTLRPVMLVWPAPGSEDTELGVLMELEVGHGETEVY
Ga0181525_1032105513300014654BogMQVGEIYIWPAPGSEDTELGVLMEPEVDHGKAEVYARVQA*
Ga0157376_1064450113300014969Miscanthus RhizosphereTSSVWPAPGSEDTELGVLMEPEVGHGETEIYAGVQA*
Ga0182041_1204158013300016294SoilMARQMERIIWPAPGFEDTELGVLMELEVGHGETEVY
Ga0182033_1149115323300016319SoilMFCGRRATWPAPGSEDTELGVLMEPEVGHGETEVYA
Ga0182033_1179593813300016319SoilDLTFDWPAPGSEDTELGVFMGPEVSHGATKVHAGIQA
Ga0182035_1132284813300016341SoilMARQMERIIWPAPGFEDTELGVLMELEVGHGETEVYARVQA
Ga0182034_1007396143300016371SoilMEVWPAPGSEDTELGVLMEPEVGHGETEVYPRVQA
Ga0182034_1089826913300016371SoilMVRPPTITPWPAPGSEDTELGVLMELEVGHGETEVYARV
Ga0187775_1039353933300017939Tropical PeatlandSVLMIWPAPGSEDTELGVTMGPEVGHGEAEVHARV
Ga0187780_1118406423300017973Tropical PeatlandFAETIYWPAPGFEDTELGVLMEPEVSHGKTTVYAGVQA
Ga0184624_1017498313300018073Groundwater SedimentADIDQIAVANWPAPGSVDTELGVLMELEVRYGEASVYAGVQA
Ga0190275_1001502963300018432SoilMLRIGFSISTWPAPGSEDTELGVLMELEVDHGEAEVYA
Ga0137408_113644513300019789Vadose Zone SoilWPAPGSEDTEPGSEDTELGVLMELEVGHGETEVYPRVQA
Ga0137408_116808613300019789Vadose Zone SoilFDKAGWPAPGSEDTELGVLMELEVGHGETEVYPRVQA
Ga0137408_124553113300019789Vadose Zone SoilWPAPGSEDTEFEDTELGVLMELEVGHGETEVYPRVQA
Ga0137408_129457643300019789Vadose Zone SoilPKELQRKSADWPAPGSEDTELGVLMELEVGHGETEVYPRVQA
Ga0137408_129457713300019789Vadose Zone SoilACTRFRGQPGSEDTELGVLMELEVGHGETEVYPRVQA
Ga0193705_102452513300019869SoilDGDILSKARLPWPAPGSEDTELGVLMELEVGHGETEVYAGVQA
Ga0193741_103609413300019884SoilPSKEIENWAAAGSEDTELGVLMEPEVDHGEAEVYTRVQA
Ga0193743_119977713300019889SoilNEVVWPAPGSEDTELGVLMEQEVGHGATEVYAGVQA
Ga0193711_100860013300019997SoilALEKLKEGRYKWPAPGSADTELGVLMEPEVCHGETEVYPRVQA
Ga0193718_102703413300019999SoilAVELMLNWPAPGSEDTELGVLMELEVGHGETEVYAGVQA
Ga0193730_104422513300020002SoilFNEICESWPAPGSEDTELGVLMELEVGHGETEVYAGVQA
Ga0193730_104495033300020002SoilATDAWPAPGSEDTELGVLMEPEVRHGETTVYAGVQA
Ga0193696_106248233300020016SoilINIDEWPAPGSEDTELGVLMELEVRHGEASVYAGVQA
Ga0194131_1038250813300020193Freshwater LakeVSAFRINSDRWPAAGSEDTKLGVNMELEVDHGATE
Ga0210407_1013386213300020579SoilCEDLYRIALNIWPAPGSADTELGVLMEPEVCHGETEVYT
Ga0210395_1018578413300020582SoilRALAWPAPGFTDTELGVLMEPEVDHGEAEVYARVQA
Ga0210395_1090996633300020582SoilDVGAVWPAPGSEDTELDVFMGPEVSHGETKVYARVQA
Ga0210408_1026241733300021178SoilQTVWPAPGSEDTELGALMELEVGHGETEVYPRVQA
Ga0210388_1035823713300021181SoilYEASYWPAPGSEDTELGVFMGPEVSHGEAKVYAGVQA
Ga0193706_104394113300021339SoilGILITKALKWPAPGSEDTELGVLMEPEVRHGEAKVYARVQA
Ga0193699_1008244933300021363SoilCAFQDWAAAGFEDTELGVNMEPEVCHGTSKVYARVQA
Ga0210387_1030025843300021405SoilGEGTVTTVWPAPGSEDTELGVLMELEVRHGETEVYP
Ga0210387_1125646013300021405SoilIVGLIVGDAVWPAPGFTDTELGVLMGPEVDHGEAEVYAGIQA
Ga0210383_1040736733300021407SoilAAGLVMVEYLRKQIDWPAPGSEDTELGVLMELEVGHGETEVHAGVQA
Ga0210384_1037331933300021432SoilDEVSGVYWPAPGSEDTELGVLMELEVGHGETEVHAGVQA
Ga0210390_1029105343300021474SoilVSRDWPAPGSADTELGVLMDLEVGHGETKIYAGVQA
Ga0210390_1055296233300021474SoilMKWPFWPAPGFTDTELGVLMEPEVDHGEAEVYARVQA
Ga0187846_1032934933300021476BiofilmNDLEWPAPGSEDTELGVLMELEVGHGETEVYARVQA
Ga0210410_1015487843300021479SoilRMIAWPAPSSEDTELGVLMGPEVGHGETKVYAGVQA
Ga0222624_142103213300021951Groundwater SedimentSEQCKTYLWPAPGSEDTELGVLMEPEVGHGETEVYAGVQA
Ga0212123_1062216613300022557Iron-Sulfur Acid SpringPKTMTEWPAPGSADTELGVLMEPEVCHGETEVYTRVQA
Ga0212128_1040199513300022563Thermal SpringsMSHLRSSGWAAAGFKDTELGVWMKPEVDHGATEVYAGVQA
Ga0222623_1006588413300022694Groundwater SedimentHQGDQYHSGAWPAPGFEDTELGVLMEPEVGHGETEVYAGVQA
Ga0242670_103864633300022708SoilPAWLKLSKDRWPAPGSEDTELGVLMEPEVGHGETEVHARVQA
Ga0247747_104791933300022737SoilKISVWPAPGSEDTELGVLMELEVGHGETEVHPGIQA
Ga0247745_100976633300022898SoilDRQSVQCGLWPAPGSEDTELGVLMEPEVRHGEAEVHA
Ga0247788_101591513300022901SoilFNSFMSIWPAPGSEDTELGVLMELEVGHGETEVHPGIQA
Ga0247752_103806913300023071SoilLAKMDKAWPAPGSEDTKFGVKMGPEVGHAEAEVYAGVQD
Ga0209986_1013667613300024433Deep SubsurfaceAERIVWPTPGSEDTELGVLMEPEVDHGTTEVYTRVQA
Ga0209642_1069814013300025167SoilEINREEIWPAPGSEDTELGVLMEPEVDHGTTEVYTRVQA
Ga0208850_107667213300025457Arctic Peat SoilESMLAQSFGAWPAPGSEDTELGVLMEPEVRHGEAEVYTRVQA
Ga0208691_113644333300025612PeatlandRNFGHWPAPGSADTELGVLMDLEVGHGETKIYAGVQA
Ga0208220_104055913300025627Arctic Peat SoilTKPSSDIQAHWSAPGFEDTELGVFMEPEVSHGETKIYARVQA
Ga0207692_1016905613300025898Corn, Switchgrass And Miscanthus RhizosphereKSDLVRWPAPGSEDTELGVLMEVEVGHGEAEVYARVQA
Ga0207654_1123369413300025911Corn RhizosphereLLFGLWPAPGSEDTELGVLMEPEVGHGETEVYAGVQA
Ga0207663_1041484213300025916Corn, Switchgrass And Miscanthus RhizosphereMITSEQCKTYLWPAPGSEDTELGVLMEPEVGHGETEVYSGVQA
Ga0207662_1108563413300025918Switchgrass RhizosphereSHLCEALWPAPGSEDTELGVLMELEVGHGETEVYARVQA
Ga0207652_1047653913300025921Corn RhizosphereMWNGLWPAPGSEDTKFGVRMGPEVGHGASEVYAGVQ
Ga0207690_1051343613300025932Corn RhizosphereEIAVWPAPGSKDTELGVLMEPEVGDGETQIYAGVQA
Ga0207709_1110642713300025935Miscanthus RhizosphereGIQKSSVWPAPGSEDTELGVLMEPEVRHGEAEVHA
Ga0207669_1023066233300025937Miscanthus RhizosphereKKNTWPAPGSEDTELGVLMELEVGHGETEVYARVQT
Ga0207704_1120508133300025938Miscanthus RhizosphereDAGLQWPAPGSKDTELGVLMEPEVGDGETQIYAGVQA
Ga0207665_1029741143300025939Corn, Switchgrass And Miscanthus RhizosphereVYSGSQNAGYGLWPAPGSEDTDLGVLMEPEVDHGETEVYPRVQA
Ga0207651_1032977933300025960Switchgrass RhizosphereSDDNIRDWPAPGSEDTELGVLMEPEVRHGEAEVYA
Ga0207668_1112553013300025972Switchgrass RhizosphereDIQEWPAPGSKDTELGVLMEPEVGDGETQIYAGVQA
Ga0207676_1036429813300026095Switchgrass RhizosphereALATWPAPGSKDTELGVLMEPEVGDGETQIYAGVQA
Ga0207683_1050403013300026121Miscanthus RhizosphereLEEGYTWPAPGSKDTELGVLMEPEVGDGETQIYAGVQA
Ga0209155_112775633300026316SoilPEKGSSVTYGDTDDWPAPGFKDTELGVSMEPEVGHGETEVYPRV
Ga0209266_123772913300026327SoilPFQLTAAIWPAPGSEDTELGVLMELEVCHGETEVYPRVQA
Ga0257149_104117013300026355SoilANDVVWPAAGSADTELGVMMEPEVCHGEAEVYTRVQA
Ga0257147_100662643300026475SoilFFKAKDWPAPGSEDTELGVLMELEVGHGETEVYARV
Ga0257147_100952533300026475SoilVVGWDGWPAPGSEDTELGVLMEPEVGHGETEVYAGVQA
Ga0257147_101394933300026475SoilHDDWPAPGSEDTELGVLMELEVGHGETEVYTRVQA
Ga0257160_100912243300026489SoilCDYHEWPAPGSEDTELGVLMELEVGHGETEVYARV
Ga0257153_102297933300026490SoilSNLDEWPAPGSEDTELGVLMELEVGHGETEVYARV
Ga0257159_101422313300026494SoilPKDTAAWPASGSEDTELGVLMELEVGHGETEVYPRVQA
Ga0209808_108066213300026523SoilISSSEPWMPQWPAPGSEDTELGVLMELEVGHGEMEVYPRVQA
Ga0207745_1000918103300026889Tropical Forest SoilFADVVWPAPGSEDTKFGVTMGPEVGHAEAEVYAGVQA
Ga0208986_100769833300027031Forest SoilLFNRLQRAFWPAPGSEDTELGVLMELEVRHGEAEVYP
Ga0208365_104289413300027070Forest SoilATFSHWPAPGSEDTELGVFMGPEVSHGETKVYAGVQA
Ga0208604_102497213300027090Forest SoilVAEWPAPGSEDTELGVFMEPEVSHGKTKVYTRVQA
Ga0209984_106566133300027424Arabidopsis Thaliana RhizosphereSVSKFEDWPAPGSEDTELGVLMGPEVRHGEAEVHARVQA
Ga0208987_100869943300027496Forest SoilTHFHRPKTSSWPAPGSEDTELGVLMELEVRHGEAEVYP
Ga0208998_105185313300027524Forest SoilDELKESETARQDVWPAPGSEDTEFGVLMEPEVRHGEAEVYAGVQA
Ga0209115_103202913300027567Forest SoilGLSVWPAPGSADTELGVLMDLEVGHGETKIYAGVQA
Ga0209527_105807233300027583Forest SoilFQCMGDVLMRGEFWPAPGSADTELGVLMEPEVCHGETEVYTGVQA
Ga0209076_104821513300027643Vadose Zone SoilLSDWPAPGSEDTELGVMMEQEVGHGETEIYTRVQA
Ga0209333_114871913300027676Forest SoilANGLIGWPAPGSEDTELGVFMGPEVSHGETTVYTRVQV
Ga0209798_1012549233300027843Wetland SedimentNSYSEIENWPAPGSEDTELGVLMEPEVGHGEAEVYTRVQA
Ga0209517_1034595623300027854Peatlands SoilDVVRVIAVQWPAPGSEETELGIFMGSEVGHGETKIHTGVQA
Ga0209814_1015537233300027873Populus RhizosphereASLAEIWPAPGSEDTELGVLMELEVGHGETEVYPRVQA
Ga0209169_1011891743300027879SoilKVACTAVMAHWPAPGFTDTELGVLMGPEVDHGEAEVYAGIQA
Ga0209481_1034568233300027880Populus RhizosphereDRKKKDPIWPAPGSEDTELGVLMELEVGHGATEVHAGVQA
Ga0209624_1007138813300027895Forest SoilSCEWPAPGSADTELGVLMDLEVGHGETKIYAGVQA
Ga0209488_1011107513300027903Vadose Zone SoilALALIVWPAPGSEDTELGVLMEPEVGHGETEVYARVQA
Ga0209415_1073207313300027905Peatlands SoilFFFSGLGQWPAPGSEDTELGVLMEPEVGHGETEVYTRVQA
Ga0209382_1029789913300027909Populus RhizosphereAKFLLSGTSRIFAPWPAPGSEDTELGVLMELEVGHGETEVYPRVQA
Ga0209382_1077035113300027909Populus RhizosphereMSIATGFALWPAPGSEDTELGVFMGPEVSHGETKVYAGVQA
Ga0209705_1014638533300027979Freshwater SedimentLSPEIWPAPGSEDTELGVLMELEVGHGETEVYAGVQA
Ga0265357_100047753300028023RhizosphereFNQTEIWPAPGSADTELGVLMEPEVCHGETEVYTRVQA
Ga0268264_1158594813300028381Switchgrass RhizosphereLALASAVWPAPGSEDTELGVLMELEVRHGEAEVHA
Ga0302169_1006512713300028679FenENTAWPAPGSEDTELGVLMELEVCHGATEVYARVQA
Ga0307285_1000696563300028712SoilRDGVYWPAPGSEDTELGVLMELEVGHGETEVYPRVQA
Ga0307309_1002031813300028714SoilPGSNYWPAPGSEDTELGVLMELEVGHGETEVYAGVQA
Ga0307298_1016467213300028717SoilEVFRDAESYYWPAPGSEDTELGVLMEPEVGHGETEVYAGVQA
Ga0307301_1005075533300028719SoilHPHEIWPAPGFEDTELGVLMEPEVGHGETEVYAGVQA
Ga0302219_1007487633300028747PalsaTEQSTNWPAPGSADTELGVLMEPEVSHGEAEVYTRVQA
Ga0307320_1043414713300028771SoilFSEMLSLDIGAIWPAPGSEDTELGVLMELEVGHGETEVYAGVQA
Ga0302208_1018989733300028774FenELSVWPAPGSEDTELGVLMELEVCHGATEVYARVQA
Ga0307290_1007025433300028791SoilHYFGWPAPGSEDTELGVLMELEVGHGETEVYAGVQA
Ga0302222_1008700113300028798PalsaLIEWPAPGSADTELGVLMEPEVDHGETEVYPRVQA
Ga0247824_1069540733300028809SoilFQFGYEFLGDPSRWPAPGSEDTELGVLMELEVGHGETEVYAGVQA
Ga0307310_1051200213300028824SoilLLSPPVRFWPAPGSEDTELGVLMELEVRHGEASVYAGVQA
Ga0302218_1005549313300028863PalsaFEVWPAPGFEDTELGVLLEPEVAHGEAEVYAGVQA
Ga0308309_1125969333300028906SoilSVLELDWPAPGSEDTELGVLMELEVGHGETEVYAGVQA
Ga0311369_1012108113300029910PalsaYDDATSTEQSTNWPAPGSADTELGVLMEPEVSHGEAEVYTRVQA
Ga0311340_1047780813300029943PalsaTGWHYFYATLDVWPAPGFEDTELGVLLEPEVAHGEAEVYAGVQA
Ga0311340_1097277233300029943PalsaAVTASRVWPAPGSADTELGVLMEPEVSHGEAEVYARVQA
Ga0311346_1059745913300029952BogKSAKWPAPGFTDTELGVLMEPEVDHGEAEVYEGVQA
Ga0311338_1105940933300030007PalsaELFARDFLWPAPGFTDTELGVLMEPEVDHGEAEVYTRVQA
Ga0310038_1040374913300030707Peatlands SoilMSTLWPAPGSADTELGVLMEPEVCHGETEVYTRVQA
Ga0302311_1025771013300030739PalsaKGVRLQFLDWPAPGFTDTELGVLMEPEVGHGETEVYTGVQA
Ga0075380_1112102433300030851SoilKYDDQWPAPGSEDTELGVFMELEVSHGKTTVYTRVQA
Ga0302180_1003007113300031028PalsaRSGPEGWPAPGSADTELGVLMEPEVSHGEAEVYTRVQA
Ga0307501_1011168513300031152SoilSTKWPAPGSEDTELGVLMELEVDHGETEVHARVQA
Ga0307495_1000891013300031199SoilTFDVAFGEWPAAGSEDTELGVLMELEVCHGETEVYTRVQA
Ga0307497_1013207933300031226SoilREIVSLFVTKWPAPGSADTELGVLMEPEVSHGKAEVYTRVQA
Ga0265325_1009439043300031241RhizospherePKKWPAPGSEDTKFGVTMGPEVRHGEAEVHAGVQA
Ga0265329_1007242613300031242RhizosphereLSFLSDNSFGDLGEWPAPGSEDTKLGVLMEPEVRHGKTEVYTRVQA
Ga0265339_1013063133300031249RhizosphereKAVYWPAPGSEDTELGVLMEPEVGHGETEIYAGVQA
Ga0307444_110375233300031360Salt MarshLAEWPAPGSEDTKFGVTMGPEVQYGGKATVYPRVQA
Ga0307506_1001841543300031366SoilPLLTNYMEWPAPGSEDTELGVLMELEVGHGETEVYARVQA
Ga0170818_10238849733300031474Forest SoilAAIDYVLWPAPGSEDTELGVLMELEVDHGETKVYARVQA
Ga0302326_1087670233300031525PalsaRQAPADRGLKIIEWPAAGSEDTELGVNMEPEVDHGTKEVYARVQA
Ga0302326_1241050113300031525PalsaYLIFKQWPAPGSADTELGVLMEPEVSHGEAEVYARVQA
Ga0318534_1003296343300031544SoilVPYEFSREGKLFWPAPGSEDTELGVLMEPEVGHGETEVYPRVQA
Ga0318538_1001962313300031546SoilLINSMTLWPAPGSEDTELGVLMEPEVGHGETEVYPRVQA
Ga0318528_1002536143300031561SoilKLFWPAPGSEDTELGVLMEPEVGHGETEVYPRVQA
Ga0318573_1012845733300031564SoilRTIVPWPAPGSEDTELGVLMEPEVGHGETEVYARVQA
Ga0318515_1002129263300031572SoilAGLWPAPGSEDTELGVLMEPEVGHGETEVYPRVQA
Ga0315550_107790943300031653Salt Marsh SedimentDRAPLWPAPGSEDTELGVLMELEVRHGEAKVYTRVQT
Ga0318560_1044502813300031682SoilSLNIAIWPAPGSEDTELGVLMELEVGHGETEVYARVQA
Ga0265314_1017900733300031711RhizosphereNQKAVYWPAPGSEDTELGVLMEPEVGHGETEIYAGVQA
Ga0265314_1017984133300031711RhizosphereKADNFAHWPAPGSEDTELGVLMELEVGHGEASVYAGVQA
Ga0265342_1015928133300031712RhizosphereFALQENFSNQKAVYWPAPGSEDTELGVLMEPEVGHGETEIYAGVQA
Ga0318496_1013240243300031713SoilTDKWPAPGSEDTELGVLMEPEVGHGETEVYARVQA
Ga0306917_1154573523300031719SoilMALAASRRFSCWPAPGSEDTELGVLMEPEVGHGETEVYPRVQA
Ga0318501_1012534913300031736SoilTIVPWPAPGSEDTELGVLMEPEVGHGETEVYARVQA
Ga0307468_10030733033300031740Hardwood Forest SoilSVSVLDLRHPEWPAPGSEDTELGVLMELEVGHGETEVHAGVQA
Ga0306918_1017795143300031744SoilKDVAIALNWPAPGSEDTELGVLMELEVGHGETEVYARVQA
Ga0318492_1011889713300031748SoilLSLFLRRIKWPAPGSEDTELGVLMEPEVGHGETEVYARVQA
Ga0318494_1063722333300031751SoilYRLAEWPAPGSEDTELGVLMELEVCHGETEVYPRVQA
Ga0318537_1007003813300031763SoilAIGKIAEWPAPGSEDTELGVLMEPEVGHGETEVYARVQA
Ga0318498_1010040613300031778SoilLRSVAKWMWPAPGSEDTELGVLMEPEVGHGETEVYARVQA
Ga0318552_1001821313300031782SoilSLAWPAPGSEDTELGVLMEPEVGHGETEVYPRVQA
Ga0318529_1009507713300031792SoilGVVWPAPGSEDTELGVLMEPEVGHGETEVYARVQA
Ga0318497_1015141213300031805SoilKTDKWPAPGSEDTELGVLMEPEVGHGETEVYARVQA
Ga0307473_1014842043300031820Hardwood Forest SoilLEAIWPAPGSEDTELGVLMELEVGHGETEVYARVQA
Ga0318567_1014962213300031821SoilIGKIAEWPAPGSEDTELGVLMEPEVGHGETEVYARVQA
Ga0318499_1006538733300031832SoilVTAFWPAPGSEDTELGVLMEPEVGHGETEVYARVQA
Ga0310917_1015292513300031833SoilLWAEAVWPAPGSEDTELGVLMEPEVGHGETEVYARVQA
Ga0310917_1076359813300031833SoilGKRKKAVWPAPGSEDTELGVLMEPEVGHGETKVYPRVQA
Ga0318511_1008845633300031845SoilLEVGIWPAPGSEDTELGVLMEPEVGHGETEVYARVQA
Ga0318512_1002321843300031846SoilRGAYWPAPGSEDTELGVLMEPEVGHGETEVYPRVQA
Ga0318527_1007631333300031859SoilIRLLERKADWPAPGSEDTELGVLMEPEVGHGETEVYARVQA
Ga0306925_1002911913300031890SoilMTLWPAPGSEDTELGVLMEPEVGHGETEVYPRVQA
Ga0306925_1025998833300031890SoilMSWKIPAWPAPGSEDTELGVLMEPEVGHGETEVYAG
Ga0318536_1013142133300031893SoilIAEWPAPGSEDTELGVLMEPEVGHGETEVYARVQA
Ga0318551_1008174113300031896SoilERPQPREAIGKIAEWPAPGSEDTELGVLMEPEVGHGETEVYARVQA
Ga0318520_1003021713300031897SoilMAQLWNRCDWPAPGSEDTELGVLMEPEVGHGETEVYP
Ga0306921_1055678333300031912SoilCEITATNIHFNWPAPGSEDTELGVLMEPEVGHGETEVYPRVQA
Ga0306921_1200075013300031912SoilNAHRIPVLVPEEWPARGSEDTELGVLMEREVGHGETEVHPRV
Ga0306921_1259437113300031912SoilMARQMERIIWPAPGFEDTELGVLMELEVGHGETEVYARVQ
Ga0310913_1018742413300031945SoilMKETRSLPRTIVPWPAPGSEDTELGVLMEPEVGHGETEVYARVQA
Ga0310910_1158743023300031946SoilMPTYKKTIWPAPGSEDTELGVLMEPEVGHGETEVYPRVQA
Ga0318531_1001665643300031981SoilRFFGWPAPGSEDTELGVLMEPEVGHGETEVYPRVQA
Ga0318563_1006985343300032009SoilYLRHWPAPGSEDTELGVLMEPEVGHGETEVYARVQA
Ga0318569_1001653043300032010SoilIAGLWPAPGSEDTELGVLMEPEVGHGETEVYPRVQA
Ga0310906_1076737733300032013SoilFKFQAAYWPAPGSEDPELGVSMEPEVDHGEAEVYARVQA
Ga0318549_1009812313300032041SoilSSSAYWPAPGSEDTELGVLMEPEVGHGETEVYARVQA
Ga0315540_1012451433300032061Salt Marsh SedimentVGPDYWPAPGSEDTKFGVTMGPEVGHGEAEVYTRVQA
Ga0318510_1034427613300032064SoilSKSFWPAPGSEDTELGVLMEPEVGHGETEVYPRVQV
Ga0318525_1013317033300032089SoilGFFGRRPIWPAPGSEDTELGVLMEPEVGHGETEVYARVQA
Ga0318525_1072059333300032089SoilSKKAVWPAPGSEDTELRCLMEREADHGETEVYAGVQA
Ga0318518_1001971743300032090SoilLNCAQYLAAFWPAPGSEDTELGVLMEPEVGHGETEVYPRVQA
Ga0307471_10059828033300032180Hardwood Forest SoilVVEGWPAAGSEDTELGVLMEPEVGHGETEVYAGVQA
Ga0307471_10071690513300032180Hardwood Forest SoilAIRGTSPWPAPGSEDTELGVLMELEVGHGETEVYTRVQA
Ga0335084_1047450933300033004SoilVMGDKWAAAGFVDTKLGVNMEPEVGHGTTEVYARVQA
Ga0335077_1049782813300033158SoilSLQLLAVWPAPGSEDTKFGVTMGPEVGHGEAEVYAGVQA
Ga0318519_1035502213300033290SoilMSWKIPAWPAPGSEDTELGVLMEPEVGHGETEVYAGVQ
Ga0318519_1091843713300033290SoilMARQMERIIWPAPGFEDTELGVLMELEVGHGETEV
Ga0310810_1046310633300033412SoilSSSVWPAPGSEDTELGVFMGLEVGHGEAAIYARVQA
Ga0310811_1047906513300033475SoilLVRESLKVWPAPGSEDTELGVLMEPEVRHGEAEVYA
Ga0316628_10074398543300033513SoilNKLVWHWPAPGSEDTKFGVTMGPEVGHGEAEVYAGVQA
Ga0364945_0040863_1_1083300034115SedimentKDKWAAAGFVDTELGVNMEPEVGHGTTEVYARVQA
Ga0370483_0074907_3_1313300034124Untreated Peat SoilAISVLLSFSDWPAPGFTDTELGVLMEPEVDHGEAEVYARVQA
Ga0370501_0050562_2_1363300034195Untreated Peat SoilSSFQVYYARHCFWPAPGSEDTELGVLMELEVRHGAASVYAGVQA


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.