NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F039114

Metagenome / Metatranscriptome Family F039114

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F039114
Family Type Metagenome / Metatranscriptome
Number of Sequences 164
Average Sequence Length 143 residues
Representative Sequence MAEKLKIDSGESKIGSKIVDIHQKNEYTKVNNYKEGMCFGCFGNGIPVGAGVNDICGDCAGKKGRETILVPIKEVVYGMCHFCGVYKHGMEQVNVRLCEKCHRKVSNIMKSYNAKGGMFEVDPFWKNMRRKHGKDWQIIMSKNLGNKR
Number of Associated Samples 129
Number of Associated Scaffolds 164

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 68.90 %
% of genes near scaffold ends (potentially truncated) 34.15 %
% of genes from short scaffolds (< 2000 bps) 59.15 %
Associated GOLD sequencing projects 109
AlphaFold2 3D model prediction Yes
3D model pTM-score0.61

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (47.561 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Marine → Oceanic → Unclassified → Marine
(35.366 % of family members)
Environment Ontology (ENVO) Unclassified
(84.146 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Saline → Water (saline)
(63.415 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 33.52%    β-sheet: 19.89%    Coil/Unstructured: 46.59%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.61
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 164 Family Scaffolds
PF04860Phage_portal 17.07
PF04586Peptidase_S78 1.22
PF00413Peptidase_M10 0.61
PF01521Fe-S_biosyn 0.61
PF04434SWIM 0.61
PF00092VWA 0.61
PF04896AmoC 0.61

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 164 Family Scaffolds
COG3740Phage head maturation proteaseMobilome: prophages, transposons [X] 1.22
COG0316Fe-S cluster assembly iron-binding protein IscAPosttranslational modification, protein turnover, chaperones [O] 0.61
COG4279Uncharacterized protein, contains SWIM-type Zn finger domainFunction unknown [S] 0.61
COG4715Uncharacterized protein, contains SWIM-type Zn finger domainFunction unknown [S] 0.61
COG4841Uncharacterized conserved protein YneR, related to HesB/YadR/YfhF familyFunction unknown [S] 0.61
COG5431Predicted nucleic acid-binding protein, contains SWIM-type Zn-finger domainGeneral function prediction only [R] 0.61
COG5549Predicted Zn-dependent proteasePosttranslational modification, protein turnover, chaperones [O] 0.61

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms73.17 %
UnclassifiedrootN/A26.83 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300000115|DelMOSum2011_c10012657All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium4354Open in IMG/M
3300000115|DelMOSum2011_c10135076Not Available752Open in IMG/M
3300000117|DelMOWin2010_c10027016All Organisms → Viruses → Predicted Viral2865Open in IMG/M
3300000148|SI47jul10_100mDRAFT_c1011011All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1807Open in IMG/M
3300000254|SI34jun09_100mDRAFT_1031564All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1027Open in IMG/M
3300000930|BpDRAFT_10489796Not Available574Open in IMG/M
3300001683|GBIDBA_10004566All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium12917Open in IMG/M
3300001838|RCM33_1006612All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium2270Open in IMG/M
3300001838|RCM33_1007086All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium2982Open in IMG/M
3300001842|RCM30_1002206Not Available3418Open in IMG/M
3300001843|RCM34_1147230Not Available611Open in IMG/M
3300001844|RCM35_1004054All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium2033Open in IMG/M
3300001934|GOS2267_102457All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium2803Open in IMG/M
3300003478|JGI26238J51125_1000083All Organisms → cellular organisms → Bacteria32785Open in IMG/M
3300003501|JGI26243J51142_1074537Not Available607Open in IMG/M
3300003650|SLW30_114552Not Available606Open in IMG/M
3300003894|Ga0063241_1003611Not Available13514Open in IMG/M
3300003894|Ga0063241_1003768All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium10686Open in IMG/M
3300004280|Ga0066606_10107165All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1052Open in IMG/M
3300005399|Ga0066860_10020287All Organisms → Viruses → Predicted Viral2603Open in IMG/M
3300005427|Ga0066851_10051073All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1407Open in IMG/M
3300005583|Ga0049085_10007235All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium4378Open in IMG/M
3300005583|Ga0049085_10007934All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium4182Open in IMG/M
3300005969|Ga0066369_10032627All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1896Open in IMG/M
3300006637|Ga0075461_10011613All Organisms → Viruses → Predicted Viral2907Open in IMG/M
3300006752|Ga0098048_1011789All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium3062Open in IMG/M
3300006752|Ga0098048_1011969All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium3037Open in IMG/M
3300006752|Ga0098048_1071920All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1065Open in IMG/M
3300006754|Ga0098044_1027701All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium2505Open in IMG/M
3300006789|Ga0098054_1021856All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium2543Open in IMG/M
3300006793|Ga0098055_1286003Not Available617Open in IMG/M
3300006802|Ga0070749_10057178All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium2360Open in IMG/M
3300006802|Ga0070749_10098293All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1732Open in IMG/M
3300006916|Ga0070750_10005397All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium6942Open in IMG/M
3300006916|Ga0070750_10018431All Organisms → Viruses → Predicted Viral3564Open in IMG/M
3300006919|Ga0070746_10001264All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium15223Open in IMG/M
3300006923|Ga0098053_1030208All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1152Open in IMG/M
3300006925|Ga0098050_1066474All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium936Open in IMG/M
3300006928|Ga0098041_1090180All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium990Open in IMG/M
3300006929|Ga0098036_1097218Not Available905Open in IMG/M
3300007234|Ga0075460_10012666All Organisms → Viruses → Predicted Viral3360Open in IMG/M
3300007276|Ga0070747_1011865All Organisms → Viruses → Predicted Viral3695Open in IMG/M
3300007346|Ga0070753_1015195All Organisms → Viruses → Predicted Viral3525Open in IMG/M
3300007514|Ga0105020_1254279All Organisms → cellular organisms → Bacteria1166Open in IMG/M
3300007538|Ga0099851_1009696All Organisms → Viruses → Predicted Viral3962Open in IMG/M
3300007539|Ga0099849_1092140All Organisms → Viruses → Predicted Viral1214Open in IMG/M
3300007637|Ga0102906_1190050Not Available554Open in IMG/M
3300007960|Ga0099850_1020854All Organisms → Viruses → Predicted Viral2908Open in IMG/M
3300007963|Ga0110931_1254397Not Available522Open in IMG/M
3300008050|Ga0098052_1281684Not Available631Open in IMG/M
3300009173|Ga0114996_10042531All Organisms → Viruses → Predicted Viral4190Open in IMG/M
3300009409|Ga0114993_10223179All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1451Open in IMG/M
3300009409|Ga0114993_11302403Not Available509Open in IMG/M
3300009420|Ga0114994_10014925All Organisms → cellular organisms → Bacteria5487Open in IMG/M
3300009420|Ga0114994_10064610All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium2507Open in IMG/M
3300009420|Ga0114994_10603938Not Available719Open in IMG/M
3300009425|Ga0114997_10033079All Organisms → Viruses → Predicted Viral3425Open in IMG/M
3300009425|Ga0114997_10105001All Organisms → Viruses → Predicted Viral1720Open in IMG/M
3300009425|Ga0114997_10162295All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1311Open in IMG/M
3300009622|Ga0105173_1102441Not Available527Open in IMG/M
3300009706|Ga0115002_10359224All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1086Open in IMG/M
3300009748|Ga0123370_1068598Not Available539Open in IMG/M
3300009786|Ga0114999_10011366All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium9538Open in IMG/M
3300010129|Ga0123376_1166543Not Available775Open in IMG/M
3300010149|Ga0098049_1109568All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium861Open in IMG/M
3300010151|Ga0098061_1001339All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium11910Open in IMG/M
3300010153|Ga0098059_1002987All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium7805Open in IMG/M
3300010299|Ga0129342_1000209Not Available23286Open in IMG/M
3300018428|Ga0181568_10917138Not Available671Open in IMG/M
3300020074|Ga0194113_10044243All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium4411Open in IMG/M
3300020084|Ga0194110_10131020All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium2007Open in IMG/M
3300020084|Ga0194110_10391269Not Available943Open in IMG/M
3300020193|Ga0194131_10084558Not Available1810Open in IMG/M
3300020221|Ga0194127_10099228All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium2167Open in IMG/M
3300020431|Ga0211554_10212363All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium930Open in IMG/M
3300020478|Ga0211503_10005068All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium10132Open in IMG/M
3300020478|Ga0211503_10081180All Organisms → cellular organisms → Bacteria1946Open in IMG/M
3300021084|Ga0206678_10293641Not Available784Open in IMG/M
3300021087|Ga0206683_10264830Not Available886Open in IMG/M
3300021957|Ga0222717_10215000All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1134Open in IMG/M
3300022043|Ga0196909_101811Not Available570Open in IMG/M
3300022063|Ga0212029_1042990Not Available649Open in IMG/M
3300022065|Ga0212024_1004978All Organisms → Viruses → Predicted Viral1761Open in IMG/M
3300022068|Ga0212021_1035592Not Available985Open in IMG/M
(restricted) 3300022931|Ga0233433_10032685All Organisms → Viruses → Predicted Viral2959Open in IMG/M
(restricted) 3300022931|Ga0233433_10150064All Organisms → Viruses → Predicted Viral1071Open in IMG/M
(restricted) 3300022933|Ga0233427_10020003All Organisms → Viruses → Predicted Viral4156Open in IMG/M
(restricted) 3300023112|Ga0233411_10036221All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1514Open in IMG/M
(restricted) 3300023208|Ga0233424_10381253Not Available532Open in IMG/M
(restricted) 3300023276|Ga0233410_10100623Not Available895Open in IMG/M
(restricted) 3300024059|Ga0255040_10270776Not Available706Open in IMG/M
(restricted) 3300024255|Ga0233438_10342071Not Available561Open in IMG/M
(restricted) 3300024518|Ga0255048_10069027All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1759Open in IMG/M
(restricted) 3300024520|Ga0255047_10025634All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium3123Open in IMG/M
3300025070|Ga0208667_1004754All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium3781Open in IMG/M
3300025083|Ga0208791_1064684Not Available613Open in IMG/M
3300025085|Ga0208792_1067191Not Available652Open in IMG/M
3300025098|Ga0208434_1069369Not Available734Open in IMG/M
3300025099|Ga0208669_1006645All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium3450Open in IMG/M
3300025099|Ga0208669_1012893All Organisms → Viruses → Predicted Viral2288Open in IMG/M
3300025103|Ga0208013_1043954All Organisms → Viruses → Predicted Viral1233Open in IMG/M
3300025103|Ga0208013_1074380All Organisms → cellular organisms → Bacteria885Open in IMG/M
3300025114|Ga0208433_1004959All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium4207Open in IMG/M
3300025118|Ga0208790_1030368All Organisms → Viruses → Predicted Viral1788Open in IMG/M
3300025128|Ga0208919_1092043All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium984Open in IMG/M
3300025128|Ga0208919_1125378Not Available811Open in IMG/M
3300025168|Ga0209337_1073874All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1676Open in IMG/M
3300025630|Ga0208004_1007220All Organisms → Viruses → Predicted Viral3858Open in IMG/M
3300025630|Ga0208004_1121941Not Available595Open in IMG/M
3300025652|Ga0208134_1047972All Organisms → Viruses → Predicted Viral1374Open in IMG/M
3300025671|Ga0208898_1153567Not Available618Open in IMG/M
3300025759|Ga0208899_1004110All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium9256Open in IMG/M
3300025873|Ga0209757_10218335Not Available605Open in IMG/M
3300025889|Ga0208644_1025185All Organisms → Viruses → Predicted Viral3667Open in IMG/M
3300026079|Ga0208748_1134300Not Available595Open in IMG/M
3300026209|Ga0207989_1163731Not Available513Open in IMG/M
3300026253|Ga0208879_1087501All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1371Open in IMG/M
3300026264|Ga0207991_1028119All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1805Open in IMG/M
3300027627|Ga0208942_1001684All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium7880Open in IMG/M
3300027627|Ga0208942_1002889All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium6013Open in IMG/M
3300027779|Ga0209709_10037455All Organisms → Viruses → Predicted Viral2933Open in IMG/M
3300027779|Ga0209709_10073578All Organisms → Viruses → Predicted Viral1877Open in IMG/M
3300027779|Ga0209709_10080244All Organisms → Viruses → Predicted Viral1770Open in IMG/M
3300027779|Ga0209709_10125545All Organisms → Viruses → Predicted Viral1298Open in IMG/M
3300027801|Ga0209091_10007949All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium7726Open in IMG/M
3300027813|Ga0209090_10057091All Organisms → Viruses → Predicted Viral2175Open in IMG/M
3300027813|Ga0209090_10528732Not Available545Open in IMG/M
3300027827|Ga0209035_10042576All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium2178Open in IMG/M
3300027838|Ga0209089_10006569Not Available9385Open in IMG/M
(restricted) 3300027861|Ga0233415_10408145Not Available651Open in IMG/M
(restricted) 3300027996|Ga0233413_10036979All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1859Open in IMG/M
(restricted) 3300028045|Ga0233414_10050453All Organisms → Viruses → Predicted Viral1713Open in IMG/M
(restricted) 3300028045|Ga0233414_10119565All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1148Open in IMG/M
3300028177|Ga0257122_1037374All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1666Open in IMG/M
3300031141|Ga0308021_10017980All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium3069Open in IMG/M
3300031141|Ga0308021_10059258All Organisms → Viruses → Predicted Viral1579Open in IMG/M
3300031142|Ga0308022_1023501All Organisms → Viruses → Predicted Viral1986Open in IMG/M
3300031142|Ga0308022_1054094All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1244Open in IMG/M
3300031142|Ga0308022_1077883All Organisms → Viruses → Predicted Viral1007Open in IMG/M
3300031143|Ga0308025_1021644All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium2564Open in IMG/M
3300031143|Ga0308025_1102697All Organisms → Viruses → Predicted Viral1049Open in IMG/M
3300031167|Ga0308023_1039162All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium927Open in IMG/M
3300031510|Ga0308010_1201745All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium719Open in IMG/M
3300031510|Ga0308010_1218917All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium681Open in IMG/M
3300031519|Ga0307488_10707810Not Available569Open in IMG/M
3300031598|Ga0308019_10009039All Organisms → Viruses → Predicted Viral4890Open in IMG/M
3300031608|Ga0307999_1033036All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1254Open in IMG/M
3300031628|Ga0308014_1003070All Organisms → Viruses → Predicted Viral4816Open in IMG/M
3300031628|Ga0308014_1004330All Organisms → Viruses → Predicted Viral3993Open in IMG/M
3300031628|Ga0308014_1098701All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium680Open in IMG/M
3300031655|Ga0308018_10032498All Organisms → Viruses → Predicted Viral1948Open in IMG/M
3300031655|Ga0308018_10091135All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1073Open in IMG/M
3300031658|Ga0307984_1004316All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium5567Open in IMG/M
3300031658|Ga0307984_1029427All Organisms → Viruses → Predicted Viral1808Open in IMG/M
3300031687|Ga0308008_1001578All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium7540Open in IMG/M
3300031688|Ga0308011_10004626Not Available5405Open in IMG/M
3300031689|Ga0308017_1005409All Organisms → Viruses → Predicted Viral3178Open in IMG/M
3300031757|Ga0315328_10114747All Organisms → Viruses → Predicted Viral1557Open in IMG/M
3300031766|Ga0315322_10116403All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1920Open in IMG/M
3300031775|Ga0315326_10231287All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1214Open in IMG/M
3300031861|Ga0315319_10154964All Organisms → Viruses → Predicted Viral1144Open in IMG/M
3300032019|Ga0315324_10056272All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium1464Open in IMG/M
3300033742|Ga0314858_068222All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → unclassified Chloroflexi → Chloroflexi bacterium882Open in IMG/M
3300034418|Ga0348337_022335All Organisms → Viruses → Predicted Viral3143Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine35.37%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous14.02%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine13.41%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater7.32%
SeawaterEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Seawater4.27%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake3.05%
Marine PlanktonEnvironmental → Aquatic → Freshwater → Lotic → Unclassified → Marine Plankton3.05%
MarineEnvironmental → Aquatic → Marine → Intertidal Zone → Unclassified → Marine3.05%
Freshwater LenticEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lentic2.44%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine2.44%
MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Marine1.83%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine1.22%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater0.61%
Subglacial FreshwaterEnvironmental → Aquatic → Freshwater → Ice → Glacial Lake → Subglacial Freshwater0.61%
Marine OceanicEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine Oceanic0.61%
MarineEnvironmental → Aquatic → Marine → Inlet → Unclassified → Marine0.61%
MarineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Marine0.61%
Sackhole BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sackhole Brine0.61%
Freshwater To Marine Saline GradientEnvironmental → Aquatic → Marine → Coastal → Unclassified → Freshwater To Marine Saline Gradient0.61%
Sea-Ice BrineEnvironmental → Aquatic → Marine → Coastal → Unclassified → Sea-Ice Brine0.61%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine0.61%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh0.61%
Estuarine WaterEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Estuarine Water0.61%
Freshwater And MarineEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Freshwater And Marine0.61%
Hydrothermal Vent PlumeEnvironmental → Aquatic → Marine → Hydrothermal Vents → Unclassified → Hydrothermal Vent Plume0.61%
SeawaterEnvironmental → Aquatic → Marine → Strait → Unclassified → Seawater0.61%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300000115Marine microbial communities from Delaware Coast, sample from Delaware MO Summer July 2011EnvironmentalOpen in IMG/M
3300000117Marine microbial communities from Delaware Coast, sample from Delaware MO Winter December 2010EnvironmentalOpen in IMG/M
3300000148Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 47 07/07/10 100mEnvironmentalOpen in IMG/M
3300000254Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - 34 06/16/09 100mEnvironmentalOpen in IMG/M
3300000930Marine microbial communities from the coastal margin of the Columbia River, USA - 33 PSU, 16mEnvironmentalOpen in IMG/M
3300001683Hydrothermal vent plume microbial communities from Guaymas Basin, Gulf of California - IDBA assemblyEnvironmentalOpen in IMG/M
3300001838Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM33, ROCA_DNA217_0.2um_bLM_C_2aEnvironmentalOpen in IMG/M
3300001842Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM30, ROCA_DNA203_0.2um_MCP-S_C_2bEnvironmentalOpen in IMG/M
3300001843Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM34, ROCA_DNA218_2.0um_bLM_C_2bEnvironmentalOpen in IMG/M
3300001844Marine plankton microbial communities from the Amazon River plume, Atlantic Ocean - RCM35, ROCA_DNA220_0.2um_bLM_C_3aEnvironmentalOpen in IMG/M
3300001934Estuary microbial communities from Chesapeake Bay, Maryland, USA - MOVE858EnvironmentalOpen in IMG/M
3300003478Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S3LV_100m_DNAEnvironmentalOpen in IMG/M
3300003501Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI037_S4LV_130m_DNAEnvironmentalOpen in IMG/M
3300003650Subglacial freshwater microbial communities from Lake Whillans, Antarctica - 3.0 micron filterEnvironmentalOpen in IMG/M
3300003894Marine microbial communities from the northern Gulf of Mexico hypoxic zone - Cultivation independent assessmentEnvironmentalOpen in IMG/M
3300004280Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - SI075_LV_DNA_100mEnvironmentalOpen in IMG/M
3300005399Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F14-07SV275EnvironmentalOpen in IMG/M
3300005427Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV65EnvironmentalOpen in IMG/M
3300005583Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG SU08MSRFEnvironmentalOpen in IMG/M
3300005969Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S7_td_Bottom_ad_4513_LV_AEnvironmentalOpen in IMG/M
3300006637Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNAEnvironmentalOpen in IMG/M
3300006752Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaGEnvironmentalOpen in IMG/M
3300006754Marine viral communities from the Subarctic Pacific Ocean - 10_ETSP_OMZ_AT15264 metaGEnvironmentalOpen in IMG/M
3300006789Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaGEnvironmentalOpen in IMG/M
3300006793Marine viral communities from the Subarctic Pacific Ocean - 17_ETSP_OMZ_AT15314 metaGEnvironmentalOpen in IMG/M
3300006802Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18EnvironmentalOpen in IMG/M
3300006916Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24EnvironmentalOpen in IMG/M
3300006919Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21EnvironmentalOpen in IMG/M
3300006923Marine viral communities from the Subarctic Pacific Ocean - 15B_ETSP_OMZ_AT15312_CsCl metaGEnvironmentalOpen in IMG/M
3300006925Marine viral communities from the Subarctic Pacific Ocean - 14_ETSP_OMZ_AT15311 metaGEnvironmentalOpen in IMG/M
3300006928Marine viral communities from the Subarctic Pacific Ocean - 8_ETSP_OMZ_AT15162 metaGEnvironmentalOpen in IMG/M
3300006929Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaGEnvironmentalOpen in IMG/M
3300007234Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_<0.8_DNAEnvironmentalOpen in IMG/M
3300007276Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31EnvironmentalOpen in IMG/M
3300007346Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_31EnvironmentalOpen in IMG/M
3300007514Marine water column microbial communities of the permanently stratified Cariaco Basin, Venezuela, November cruise - 143m, 2.7-0.2um, replicate aEnvironmentalOpen in IMG/M
3300007538Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_2 Viral MetaGEnvironmentalOpen in IMG/M
3300007539Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1M Viral MetaGEnvironmentalOpen in IMG/M
3300007637Estuarine microbial communities from the Columbia River estuary - metaG 1556A-02EnvironmentalOpen in IMG/M
3300007960Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaGEnvironmentalOpen in IMG/M
3300007963Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (version 2)EnvironmentalOpen in IMG/M
3300008050Marine viral communities from the Subarctic Pacific Ocean - 15_ETSP_OMZ_AT15312 metaGEnvironmentalOpen in IMG/M
3300009173Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_134EnvironmentalOpen in IMG/M
3300009409Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_150EnvironmentalOpen in IMG/M
3300009420Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152EnvironmentalOpen in IMG/M
3300009425Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_136EnvironmentalOpen in IMG/M
3300009622Marine viral communities from the Southern Atlantic ocean transect to study dissolved organic matter and carbon cycling - metaG 3321_4155EnvironmentalOpen in IMG/M
3300009706Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB11_86EnvironmentalOpen in IMG/M
3300009748Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_210_18m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009786Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_126EnvironmentalOpen in IMG/M
3300010129Marine microbial and viral communities from Louisana Shelf, Gulf of Mexico - GoM_2015_C6C_237_18m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300010149Marine viral communities from the Subarctic Pacific Ocean - 13B_ETSP_OMZ_AT15268_CsCl metaGEnvironmentalOpen in IMG/M
3300010151Marine viral communities from the Subarctic Pacific Ocean - 22_ETSP_OMZ_AT15343 metaGEnvironmentalOpen in IMG/M
3300010153Marine viral communities from the Subarctic Pacific Ocean - 20_ETSP_OMZ_AT15318 metaGEnvironmentalOpen in IMG/M
3300010299Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Sum_15_0.2_DNAEnvironmentalOpen in IMG/M
3300018428Coastal salt marsh microbial communities from the Groves Creek Marsh, Skidaway Island, Georgia - 101404AT metaG (megahit assembly)EnvironmentalOpen in IMG/M
3300020074Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015017 Mahale Deep Cast 200mEnvironmentalOpen in IMG/M
3300020084Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015032 Kigoma Deep Cast 1200mEnvironmentalOpen in IMG/M
3300020193Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015053 Kigoma Offshore 120mEnvironmentalOpen in IMG/M
3300020221Freshwater microbial communities from Lake Tanganyika, Tanzania - TA2015036 Kigoma Deep Cast 100mEnvironmentalOpen in IMG/M
3300020431Marine microbial communities from Tara Oceans - TARA_B100001142 (ERX556101-ERR598983)EnvironmentalOpen in IMG/M
3300020478Marine microbial communities from Tara Oceans - TARA_B100000029 (ERX556025-ERR599111)EnvironmentalOpen in IMG/M
3300021084Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 12015EnvironmentalOpen in IMG/M
3300021087Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M2 80m 12015EnvironmentalOpen in IMG/M
3300021957Estuarine water microbial communities from San Francisco Bay, California, United States - C33_18DEnvironmentalOpen in IMG/M
3300022043Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1508_1D Viral MetaG (v3)EnvironmentalOpen in IMG/M
3300022063Freshwater to marine saline gradient viral communities from Chesapeake Bay - CB_1504_1 Viral MetaG (v2)EnvironmentalOpen in IMG/M
3300022065Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (v2)EnvironmentalOpen in IMG/M
3300022068Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_21 (v2)EnvironmentalOpen in IMG/M
3300022931 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_122_August2016_100_MGEnvironmentalOpen in IMG/M
3300022933 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_118_April2016_100_MGEnvironmentalOpen in IMG/M
3300023112 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_2_MGEnvironmentalOpen in IMG/M
3300023208 (restricted)Freshwater microbial communities from Lake Towuti, South Sulawesi, Indonesia - Watercolumn_Towuti2014_125_MGEnvironmentalOpen in IMG/M
3300023276 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_1_MGEnvironmentalOpen in IMG/M
3300024059 (restricted)Seawater microbial communities from Strait of Georgia, British Columbia, Canada - BC1_12_2EnvironmentalOpen in IMG/M
3300024255 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - SI_123_September2016_10_MGEnvironmentalOpen in IMG/M
3300024518 (restricted)Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_2EnvironmentalOpen in IMG/M
3300024520 (restricted)Seawater microbial communities from Jervis Inlet, British Columbia, Canada - JV7_2_1EnvironmentalOpen in IMG/M
3300025070Marine viral communities from the Subarctic Pacific Ocean - 11B_ETSP_OMZ_AT15265_CsCl metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025083Marine viral communities from the Subarctic Pacific Ocean - 11_ETSP_OMZ_AT15265 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025085Marine viral communities from the Subarctic Pacific Ocean - 14_ETSP_OMZ_AT15311 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025098Marine viral communities from the Subarctic Pacific Ocean - 13_ETSP_OMZ_AT15268 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025099Marine viral communities from the Subarctic Pacific Ocean - 21_ETSP_OMZ_AT15319 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025103Marine viral communities from the Subarctic Pacific Ocean - 16_ETSP_OMZ_AT15313 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025114Marine viral communities from the Subarctic Pacific Ocean - 3_ETSP_OMZ_AT15126 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025118Marine viral communities from the Subarctic Pacific Ocean - 10_ETSP_OMZ_AT15264 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025128Marine viral communities from the Subarctic Pacific Ocean - 4_ETSP_OMZ_AT15127 metaG (SPAdes)EnvironmentalOpen in IMG/M
3300025168Marine viral communities from the Pacific Ocean - LP-53 (SPAdes)EnvironmentalOpen in IMG/M
3300025630Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Fall_15_>0.8_DNA (SPAdes)EnvironmentalOpen in IMG/M
3300025652Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_31 (SPAdes)EnvironmentalOpen in IMG/M
3300025671Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Mar_4 (SPAdes)EnvironmentalOpen in IMG/M
3300025759Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_24 (SPAdes)EnvironmentalOpen in IMG/M
3300025873Marine viral communities from the Pacific Ocean - ETNP_6_1000 (SPAdes)EnvironmentalOpen in IMG/M
3300025889Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Nov_18 (SPAdes)EnvironmentalOpen in IMG/M
3300026079Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S7_td_Bottom_ad_4513_LV_A (SPAdes)EnvironmentalOpen in IMG/M
3300026209Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP201406SV65 (SPAdes)EnvironmentalOpen in IMG/M
3300026253Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Knorr_S15_td_Bottom_ad_5009_LV_A (SPAdes)EnvironmentalOpen in IMG/M
3300026264Marine microbial and viral communities from oxygen minimum zone, Eastern Pacific Ocean - ETNP2014F14-07SV275 (SPAdes)EnvironmentalOpen in IMG/M
3300027627Freshwater lentic microbial communities from great Laurentian Lakes, MI, USA - Great Lakes metaG SU08MSRF (SPAdes)EnvironmentalOpen in IMG/M
3300027779Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB4_136 (SPAdes)EnvironmentalOpen in IMG/M
3300027801Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB8_128 (SPAdes)EnvironmentalOpen in IMG/M
3300027813Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_152 (SPAdes)EnvironmentalOpen in IMG/M
3300027827Marine microbial communities from the Southern Atlantic Ocean, analyzing organic carbon cycling - AAIW_A/KNORR_S2/LV (SPAdes)EnvironmentalOpen in IMG/M
3300027838Marine microbial communities from western Arctic Ocean - ArcticOcean_MG_CB2_150 (SPAdes)EnvironmentalOpen in IMG/M
3300027861 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_12_MGEnvironmentalOpen in IMG/M
3300027996 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_6_MGEnvironmentalOpen in IMG/M
3300028045 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_10_MGEnvironmentalOpen in IMG/M
3300028177Marine microbial communities from Saanich Inlet, British Columbia, Canada - SI106_120EnvironmentalOpen in IMG/M
3300031141Marine microbial communities from water near the shore, Antarctic Ocean - #351EnvironmentalOpen in IMG/M
3300031142Marine microbial communities from water near the shore, Antarctic Ocean - #353EnvironmentalOpen in IMG/M
3300031143Marine microbial communities from water near the shore, Antarctic Ocean - #422EnvironmentalOpen in IMG/M
3300031167Marine microbial communities from water near the shore, Antarctic Ocean - #418EnvironmentalOpen in IMG/M
3300031510Marine microbial communities from water near the shore, Antarctic Ocean - #129EnvironmentalOpen in IMG/M
3300031519Sea-ice brine microbial communities from Beaufort Sea near Barrow, Alaska, United States - SB 0.2EnvironmentalOpen in IMG/M
3300031598Marine microbial communities from water near the shore, Antarctic Ocean - #284EnvironmentalOpen in IMG/M
3300031608Marine microbial communities from water near the shore, Antarctic Ocean - #1EnvironmentalOpen in IMG/M
3300031628Marine microbial communities from water near the shore, Antarctic Ocean - #229EnvironmentalOpen in IMG/M
3300031655Marine microbial communities from water near the shore, Antarctic Ocean - #282EnvironmentalOpen in IMG/M
3300031658Marine microbial communities from Ellis Fjord, Antarctic Ocean - #78EnvironmentalOpen in IMG/M
3300031687Marine microbial communities from water near the shore, Antarctic Ocean - #125EnvironmentalOpen in IMG/M
3300031688Marine microbial communities from water near the shore, Antarctic Ocean - #177EnvironmentalOpen in IMG/M
3300031689Marine microbial communities from water near the shore, Antarctic Ocean - #280EnvironmentalOpen in IMG/M
3300031757Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 200m 32315EnvironmentalOpen in IMG/M
3300031766Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 100m 21515EnvironmentalOpen in IMG/M
3300031775Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 80m 32315EnvironmentalOpen in IMG/M
3300031861Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 500m 3416EnvironmentalOpen in IMG/M
3300032019Ammonia-oxidizing marine archaeal communities from Monterey Bay, California, United States - M1 500m 21515EnvironmentalOpen in IMG/M
3300033742Sea-ice brine viral communities from Beaufort Sea near Barrow, Alaska, United States - 2018 seawaterEnvironmentalOpen in IMG/M
3300034418Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - Viral MetaG DEL_Aug_28 (v4)EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
DelMOSum2011_1001265733300000115MarineMAEKLKIDSGESKIGSKIVDIHQKNEYTKVNNYKEGMCFGCFGNGIPVGAGVNDICGDCAGKKGRETILVPIKEVVYGMCHFCGVYKHGMEQVNVRLCEKCHRKVSNIMKSYNAKGGMFEVDPFWKNMRRKHGKDWQIIMSKNLGNKR*
DelMOSum2011_1013507623300000115MarineMAEKIKIDSGESKIGSKIVDIHQKNEYTKVNNYKEGMCFGCFGNGIPVGAGVNDICGDCAGKKGRETILVPIKEVIYGMCHFCGEYKHGLEQVNVRLCQKCHKKVSNVMKSYNAKGGMFEVDPFWKNMRRKHGKDWQIIMSKNLGNRR*
DelMOWin2010_1002701613300000117MarineMPTELDVNTGGTDLGNKIWDIHQSSEYTKVNNYKEGMCYNCFGNNAVAALVLDICGDCAGTRGRETILVPIKSVYYGLCFFCGKHKFNLEQINGRLCHKCHRKCANHIKEYNKKGGQFGADPFWQRMRKKHGKDWKVIFDNGLANPR*
SI47jul10_100mDRAFT_101101153300000148MarineMATKLDLNSGGTDLGKKVIDIHQNNEYTKVNNYKEGLCFGCFGSNVVGALVADICGDCAGKKGREPLLVSIKPVYYGMCHFCGVYKFNMEQVNCRLCQKCHRKTANHMKDYNQKGGMHGADPFWKSMRRKHGKDWKQIMSNGTKSYRQ*
SI34jun09_100mDRAFT_103156433300000254MarineGSKIVDIHQKNEYTRVNNYKEGMCFSCFGNGIPVGAGVNDICGDCAGKKGRETILVPIKEIVYGMCHFCGEYKHGMEQINARLCQKCHRKVSNIMKSYNAKGGMFEVDPFWKSMRRKHGKDWQHILGKNLGNKR*
BpDRAFT_1048979613300000930Freshwater And MarineTRVNNYKEGMCFSCFGNGIPVGAGVNDICGDCAGKKGRETILVPIKEVVYGMCHFCGVYKHGLEQVNVRLCEKCHRKVANIMKAYNTKGGMFEVDPFWKNMRRKHGKDWQIIMSKNLGNKR*
GBIDBA_10004566143300001683Hydrothermal Vent PlumeMATKLDLNSGGTDIGKKVIDIHQKNEYTHVNNYKEGICFGCFGNNVVGALVADICGDCAGKKGREPLLVSIKPIYYGMCHFCGIYKFNMEQVNCRLCQKCHRKTANHMKEYNKVGGMHGADPFWKSMRRKHGKDWKQIMTNGTKSYRQ*
RCM33_100661243300001838Marine PlanktonMATKLNVNTGGTAMGNKIWDIHQRSEYTKVNNYKEGMCFNCFESNAVSALVLDICGDCAGKRGRETILVPIKQVYYGLCYFCGTYKFNMEQINARLCHKCHRRTADVMKDYNKKGGMFNVDPFWVKQRKRNGKDWRIIFGQGLGNRK*
RCM33_100708623300001838Marine PlanktonMAEKVNINGGQTDIGKKIIDIHQRNEYTRVNSYKEGMCFNCFGNNAVSALVLDICGDCAGKRGRETILVPIKNVYYGLCYFCGTYKFNMEQINARLCHKCHRKVANVTRDYNKKGGMFNVDPFWVRQRKKNGKDWRQIFSNNLGNKR*
RCM30_100220683300001842Marine PlanktonYTRVNSYKEGMCFNCFGNNAVSALVLDICGDCAGKRGRETILVPIKNVYYGLCYFCGTYKFNMEQINARLCHKCHRKVANVTRDYNKKGGMFNVDPFWVRQRKKNGKDWRQIFSNNLGNKR*
RCM34_114723023300001843Marine PlanktonMGNKIWDIHQRSEYTKVNNYKEGMCFNCFESNAVSALVLDICGDCAGKRGRETILVPIKQVYYGLCYFCGTYKFNMEQINARLCHKCHRRTADVMKDYNKKGGMFNVDPFWVXXXXXXXXXXXXXFGQGLGNRK*
RCM35_100405443300001844Marine PlanktonMATKLNVNTGGTAMGNKIWDIHQRSEYTKVNNYKEGMCFNCFESNAVSALVLDICGDCAGKRGRETILVPIKQVYYGLCYFCGTYKFNMEQINARLCHKCHRRTADVMKDYNKKGGMFNVDPFWVKQRKRNGKDWRIIFGQGLGNRR*
GOS2267_10245753300001934MarineNTGNTDLGKKIWDIHQNNEYTKVNNYKEGMCYNCFENNAVAALVLDICGDCAGKRGRETILVPIKQVYYGMCYFCGDYKFNLEQINGRLCTKCHRRCATHIKDYNKKGGQFGADPFWKSVKRRHGQDWKLIMNDPSQSYRR*
JGI26238J51125_1000083213300003478MarineVAEKVKIDSGQTKIGSKIVDIHQKNEYTRVNNYKEGMCFSCFGNGIPVGAGVNDICGDCAGKKGRETILVPIKEIVYGMCHFCGEYKHGMEQINARLCQKCHRKVSNIMKSYNAKGGMFEVDPFWKSMRRKHGKDWQHILGKNLGNKR*
JGI26243J51142_107453713300003501MarineEKVKIDSGQTKIGSKIVDIHQKNEYTRVNNYKEGMCFSCFGNGIPVGAGVNDICGDCAGKKGRETILVPIKEIVYGMCHFCGEYKHGMEQINARLCQKCHRKVSNIMKSYNAKGGMFEVDPFWKSMRRKHGKDWQHILGKNLGNKR*
SLW30_11455213300003650Subglacial FreshwaterMATKLDVNTGGTKIGAKIWEIHQRNEYTHVDNYKEGMCFGCFGNNVVGALVSDICGDCAGKRGRETILVPIKTVIYGLCHFCGIYKFNMEQVNVRLCFKCHRKVADVMRDFNKKGGMYKVDPFWVNQSRKNGKDWRVIFDGGSKTRL*
Ga0063241_1003611143300003894MarineMATKLDLNSGGTDMGKKIVDIHQKNEYTAVNNYKEGLCFGCFGSNVVGALVADICGDCAGKKGREPLLVSIKPVYYGMCHFCGVYKFNMEQINCRLCQKCHRRTSDHMKAYNKAGGMHGADPFWKSIRRKHGKDWKHIMTNGTKSYRQ*
Ga0063241_100376833300003894MarineMATKLDVNTGGTDLGKKIWEVHQKNEETRVNNYKEAVCFGCLKNDAAGAGVFDICGDCAGKRGREPLLVSIKPVYYGLCYFCGKYKFNMEQINARLCKRCHEKVAKVMKNYNKQGGQFGADPFWQKQRKKHGKDWKIIFSQGLGNSR*
Ga0066606_1010716513300004280MarineVAEKVKINSGQTKIGSKIVDIHQKNEYTRVNNYKEGMCFSCFGNGIPVGAGVNDICGDCAGKKGRETILVPIKEIVYGMCHFCGEYKHGMEQINARLCQKCHRKVSNIMKSYNAKGGMFEVDPFWKSMRRKHGKDWQHILGKNLGNKR*
Ga0066860_1002028733300005399MarineMATKLDLNSGGTDIGNKIIEIHQRNEYTAVNNYKEGLCFGCFGSNVVGALVADICGDCAGKKGREPLLVSIKPIYYGMCHFCGIYKFNMEQINCRLCFKCHRRTANHMKDYNKKGGMHGADPFWKSMRRKHGKDWKQIMSNGTKSWRQ*
Ga0066851_1005107333300005427MarineMATKLNLDSGGTDIGNKIVDIHQKNEYTAVNNYKEGLCFGCFGNNVVGALVADICGDCAGKKGREPLLVSIKPIYYGMCHFCGVYKFNMEQINCRLCKKCHRRTANHMKEYNKKGGMHGADPFWQSMRKKHGKDWKQIMNNGTKSYRQ*
Ga0049085_1000723553300005583Freshwater LenticMATKLDVNVGQSDIGKKIWSIHQKNEWTKVNNYKEAVCFSCLKSDAAAALVVDICGDCAGKRGRESILVPIKEVYHGLCYFCGTYKFHMEQINCRLCHPCHKRVANVMTAYNKKGGLFGADPFWVKQRKKYGKDWKLMFSGNGGNPR*
Ga0049085_1000793423300005583Freshwater LenticMTTKLDVNVGTTDVGKKIWDIHQKNEYTKVNNYKEAMCFGCFTTDAAAALVADICGDCASKKGRETLLVSIKPVIYGLCHFCGIYKFNMEQMNIRLCFNCHKKVANIMKNFNKQGGMFNVDPFWKKMRIKHGKDWQHQFNNNTGNNR*
Ga0066369_1003262723300005969MarineMATKLNLNAGSTAMGKKIVDIHQKNEYTHVNNYKEGMCFGCFGSNVVGAMVADVCGDCAGKRGRETLLVSVKSVYYGMCHFCGDYKFNMEQINCRLCQKCHIRNARHMKSYNKKGGMYGADPFWVSQRRKLGKDYKQIMSSGTKSWRK*
Ga0075461_1001161313300006637AqueousMATKLDVNTGNTDLGKKIWDIHQNNEYTKVNNYKEGMCYNCFESNAVAALVLDICGDCAGKRGRETILVPIKQVYYGMCYFCGDYKFNLEQINGRLCTKCHKRCANHIKDYNKKGGQFGADPFWKSVKRRHGQDWKLIMNDPSQSY
Ga0098048_101178933300006752MarineMATKLDVNTGGTKLGDKIWDIHQKSEYTKVNEYKEGMCFSCFKTGVPVGAGVNDICGDCAGKKGRETILVPIKGVYYGMCHFCGKYKFNMEQINCRLCQRCHERCAKHIKNYNLKGGQFGADPFWQKMRKKHGKDWKIIFNNGLGNQR*
Ga0098048_101196923300006752MarineMATKLDVNTGNTYLGKKIWETHQKNEETHVNEYKEATCFGCLKSDAAAAGVFDICGDCAGKRGRETLLVSIKGVYYGICYFCGEHKFNMEQINARLCRRCSRKVADVIKDYNKKGGQFGADPFWIRMRKKHGKDWKVAFNGNGTINSR*
Ga0098048_107192023300006752MarineMAEKLKIDSGESKIGSKIVDIHQKNEYTKVNHYKEGMCFSCFGNGIPVGAGVNDICGDCAGKKGRETILVPIKEVVYGMCHFCGVYKHGLEQVNVRLCEKCHRKVANVMKAYNKKGGMFEVDPFWKNMRRKHGKDWQIIMSKNLGNKR*
Ga0098044_102770133300006754MarineMATKLDVNHGDTDIGKKIWDIHQDNEYTKVNNYKEAVCFGCLKNDAAAAMVADICGECAGKRGRETLLVSIKPVYYGLCYFCGHYKFNMEQINCRLCRTCSRRVANVMKDYNKKGGFQGADPFWQRIKKKHGKDWKQIMNNGTKSYRQ*
Ga0098054_102185653300006789MarineMATKLNLDGGKTNLGKKIVDIHQENEYTHVDNYKEGLCFGCFTKNVVGALVLDCCGNCAGKRGRETLLVKIKDVYYGMCYFCGKYEFNLEQINARLCRKCHRRVADVMKDYNKKGGQFGADPFWVRQRKKNGKDWKQIFSKNLGNNR*
Ga0098055_128600323300006793MarineMKHYRG*SWLATKLDVNHGQTYLGKKIWETHQKNEETHVNNYKEAVCFGCLRNDAAGAGIFDICGNCAGKRGRETLLVTIKPVYYGICYFCGEHKFNMEQINARLCRKCSRGVADNIKEYNKKGGQFGADPFWI
Ga0070749_1005717853300006802AqueousMATKLDVNVGNTDLGKKIWKIHQDNEYTKVNNYKEGMCYNCFESNAVAALVLDICGDCAGKRGRETILVPIKQVYYGMCYFCGDYKFNLEQINGRLCTKCHRRCATHIKDYNKKGGQFGADPFWKSVKRRHGQDWKLIMNDPSQSYRR*
Ga0070749_1009829313300006802AqueousMATKLDVNVGNTDLGKKIWDIHQNNEYTKVNNYKEGMCYNCFENNAVAALVLDICGDCAGKRGRETILVPIKQVYYGMCYFCGDYKFNLEQINGRLCTKCHKRCATHIKEYNKKGGQFGADPFWKSVKRRHGQDWKLIMNDPSQSYRR*
Ga0070750_1000539783300006916AqueousMATKLDVNTGNTDLGKKIWDIHQNNEYTKVNNYKEGMCYNCFESNAVAALVLDICGDCAGKRGRETILVPIKQVYYGMCYFCGDYKFNLEQINGRLCTKCHRRCATHIKDYNKKGGQFGADPFWKSVKRRHGQDWKLIMNDPSQSYRR*
Ga0070750_1001843153300006916AqueousMPTELDVNTGGTDLGNKIWDIHQSSEYTKVNNYKEGMCYNCFGNNAVAALVLDICGDCAGTRGRETILVPIKSVYYGLCFFCGKHKFNLEQINGRLCHKCHRRCANHIKEYNKKGGQFGADPFWQRMRKKHGKDWKVIFDNGLANPR*
Ga0070746_10001264263300006919AqueousMATKLDVNTGNTDLGKKIWDIHQNNEYTKVNNYKEGMCYNCFESNAVAALVLDICGDCAGKRGRETILVPIKQVYYGMCYFCGDYKFNLEQINGRLCTKCHRRCANHIKDYNKKGGQFGADPFWKSVKRRHGQDWKLIMNDPSQSYRR*
Ga0098053_103020833300006923MarineLDVNTGSTYLGKKIWETHQKHEETKVNNYKEAVCFGCLKNDAAAAGVFDICGECAGKRGREALLVSIKPVYYGMCYFCGIYKFHMEQINARLCRRCMRRVADVMKAYNKKGGQFGADPFWVKQRKKNGKDWRQIFGGNLGNQR*
Ga0098050_106647413300006925MarineIMAEKLKIDSGESKIGSKIVDIHQKNEYTKVNHYKEGMCFSCFGNGIPVGAGVNDICGDCAGKKGRETILVPIKEVVYGMCHFCGVYKHGLEQVNVRLCEKCHRKVANVMKVYNKKGGMFEVDPFWKNMRRKHGKDWQIIMSKNLGNKR*
Ga0098041_109018023300006928MarineMAEKLKIDSGESKIGSKIVDIHQKNEYTKVNHYKEGMCFSCFGNGIPVGAGVNDICGDCAGKKGRETILVPIKEVVYGMCHFCGVYKHGLEQENVRLCEKCHRKVANVMKAYNKKGGMFEVDPFWKNMRRKHGKDWQIIMSKNLGNKR*
Ga0098036_109721833300006929MarineMKHYRG*SWLATKLDVNHGQTYLGKKIWETHQKNEETHVNNYKEAVCFGCLRNDAAGAGIFDICGNCAGKRGRETLLVTIKPVYYGICYFCGEHKFNMEQINARLCRKCSRGVADNIKEYNKKGGQFGADPFWIRMRKKHGKDWRAAFSGNGTINKR*
Ga0075460_1001266613300007234AqueousTGGTDLGNKIWDIHQSSEYTKVNNYKEGMCYNCFGNNAVAALVLDICGDCAGTRGRETILVPIKSVYYGLCFFCGKHKFNLEQINGRLCHKCHRRCANHIKEYNKKGGQFGADPFWQRMRKKHGKDWKVIFDNGLANPR*
Ga0070747_101186573300007276AqueousMAEKIKIDSGESKIGSKIVDIHQKNEYTKVNNYKEGMCFGCFGNGIPVGAGVNDICGDCAGKKGRETILVPIKEVIYGMCHFCGEYKHGLEQVNVRLCQKCHKKVSNVMKSYNAKGGMFEVDPFWKNMRRKHGKDWQIIMSKNL
Ga0070753_101519563300007346AqueousMATKLDVNTGNTDLGKKIWDIHQNNEYTKVNNYKEGMCYNCFESNAVAALVLDICGDCAGKRGRETILVPIKQVYYGMCYFCGDYKFNLEQINGRLCTKCHKRCANHIKDYNKKGGQFGADPFWKSVKRRHGQDWKLIMNDPSQSYRR*
Ga0105020_125427923300007514MarineMPTELDVNTGNTDLGKKIWEIHQKNEETHVNAYKEAVCFGCLKNDAAGAGIFDICGDCAGKRGREALLVSVKPIYYGLCYFCGEYKFHMEQINVRLCKRCHERVAKIMKKYNQQGGQFGADPFWQRMRKKHGKDWKIIMSKGLGNKR*
Ga0099851_100969633300007538AqueousMATKLDVNTGNTDLGKKIWDIHQNNEYTKVNNYKEGMCYNCFENNAVAALVLDICGDCAGKRGRETILVPIKQIYYGMCYFCGDYKFNLEQINGRLCTKCHRRCATHIKDYNKKGGQFGADPFWKSVKRRHGQDWKLIMNDPSQSYRR*
Ga0099849_109214013300007539AqueousMPTELDVNTGGTDLGNKIWDIHQNNEYTKVNNYKEGMCYNCFGNNAVAALVLDICGDCAGTRGRETILVPIKQVYYGLCFFCGKHKFNLEQINGRLCHKCHRRCANHIKEYNKKGGQFGADPFWQRMRKKHGKDWKVIFDNGLANPR*
Ga0102906_119005023300007637EstuarineVAEKVKINSGQTKIGSKIVDIHQKNEYTRVNNYKEGMCFSCFGNGIPVGAGVNDICGDCAGKKGRETILVPIKEIVYGMCHFCGEYKHGMEQINARLCQKCHRKVSNIMKSYNAKGGMFEVDPFW
Ga0099850_102085463300007960AqueousMATKLDVNIGNTDLGKKIWDIHQNNEYTKVNNYKEGMCYNCFENNAVAALVLDICGDCAGKRGRETILVPIKQIYYGMCYFCGDYKFNLEQINGRLCTKCHRRCATHIKDYNKKGSQFGADPFWKSVKRRHGQDWKLIMNDPSQSYRR*
Ga0110931_125439713300007963MarineMAEKLKIDSGESKIGSKIVDIHQKNEYTKVNHYKEGMCFSCFGNGIPVGAGVNDICGDCAGKKGRETILVPIKEVVYGMCHFCGVYKHGLEQVNVRLCEKCHRKVSNIMKAYNKKGGMFEVDPFWKNMRRKHGKDWQIIMSKNLG
Ga0098052_128168423300008050MarineMATKLNLDSGGTDIGNKIVDIHQKNEYTAVNNYKEGLCFGCFGNNVVGALVADICGDCAGKKGREPLLVSIKPIYYGMCHFCGVYKHGLEQVNVRLCEKCHRKVANVMKVYNKKGGMFEVDPFW
Ga0114996_1004253133300009173MarineMAEKVKIDSGQTKIGSKIIDIHQSNEYTKVNSYKEGMCFGCFDHGVPVGAGVSDICGDCAGKKGRETILVPIKEIVYGMCHFCGEYKHGMEQINARLCQKCHRKVSNVMKAYNNKGGMFEVDPFWKNMRRKHGKDWQIIMSKNLGNRR*
Ga0114993_1022317933300009409MarineMAEKVNLDSGGTKIGKKIIDIHQSNEYTKVNDYKEGLCFGCFDNGVAVGAGVVDICGDCAGKKGREAILVPIKEVYYGLCYFCGGYKFHMEQVNARLCQKCHRRVSNVMKAFNKKGGMYAVDPFWKNMRRKHGKDWQQIMSQGLGNRR*
Ga0114993_1130240313300009409MarineIMAEKVKIDSGQTKIGSKIIDIHQSNEYTRVNSYKEGMCFGCFGNGIPVGAGVSDICGDCAGKKGRETILVPIKEIVYGMCHFCGEYKHGMEQINARLCQKCHRKVSNVMKAYNRKGGMFEVDPFWKNMRRKHGKDWQIIMSKNLGNRR*
Ga0114994_1001492513300009420MarineNEYTRVNNYKEGMCFGCFGNGIPVGAGVSDICGDCAGKKGRETILVPIKEIIYGLCHFCGEFKHHLEQINARLCQKCHRRVSNHMKSYNLKGGMLETDPFWKSQRRKHGKDWAHIMSKDLGNPR*
Ga0114994_1006461053300009420MarineMAEKVKIDSGQTKIGSKIIDIHQSNEYTRVNSYKEGMCFGCFGNGIPVGAGVSDICGDCAGKKGRETILVPIKEIVYGMCHFCGEYKHGMEQINARLCQKCHRKVSNVMKAYNQKGGMFEVDPFWKNMRRKHGKDWQIIMSKNLGNKR*
Ga0114994_1060393833300009420MarineMAESLKIDSGKTKIGNKIIDIHQSNEYTKVNNYKEGMCFGCFGNGIAVGAGVNDICGDCAGKKGRETILVPIKEVIYGMCHFCGVYKHNLEQVNVRLCQKCHKKVSNIMKSYNKKGGMFEVDPFWKSMRRKHG
Ga0114997_1003307933300009425MarineMAESLKIDSGKTKIGNKIIDIHQSNEYTKVNNYKEGMCFGCFGNGIAVGAGVNDICGDCAGKKGRETILVPIKEVIYGMCHFCGVYKHNLEQVNVRLCQKCHKKVSNIMKSYNKKGGMFEVDPFWKSMRRKHGKDWQHVLGKNLGNSR*
Ga0114997_1010500133300009425MarineMAEKVKIESGGTKIGSKIVDIHQKNEYTRVNDYKEGMCFGCFGHGIPVGAGVSDICGDCAGKKGRETILVPIKEIVYGMCHFCGDFKHGLEQINARLCIKCTRRVSNHFKNYNRNGGMLETDPFWKSQRRKHGKDWAHIMSKDLGNPR*
Ga0114997_1016229533300009425MarineMAEKFEVKTGGTKIGDKIVDIHQKNEYTRVNNYKEGMCFGCFGNGIPVGAGVSDICGDCAGKKGRETILVPIKEIIYGLCHFCGEFKHHLEQINARLCQKCHRRVSNHMKSYNLKGGMLETDPFWKSQRRKHGKDWAHIMSKDLGNPR*
Ga0105173_110244113300009622Marine OceanicMATKLNLNAGSTEMGKKIVDIHQKNEYTHVNNYKEGMCFGCFGSNVVGAMVADVCGDCAGKRGRETLLVSVKSVYYGMCHFCGDYKFNMEQINCRLCQKCHIRNARHMKSYNKKGGMYGADPFWVSQRRKLGKDYKQIMSSGTKSW
Ga0115002_1035922433300009706MarineMAEKVNLDSGGTKIGKKIIDIHQSNEYTKVNDYKEGLCFGCFDNGVAVGAGVVDICGDCAGKKGREAILVPIKEVYYGLCYCCGGYKFHMEQVNARLCQKCHRRVSNVMKAFNKKGGMYAVDPFWKNMRRKHGKDWQQIMSQ
Ga0123370_106859813300009748MarineMATKLDVNTGGTKLGDKIWDIHQKNEYTKVNEYKEGMCFNCFKTGIPVGAGVNDICGDCAGKRGRETILVPIKGVYYGMCHFCGKYKFNMEQVNVRLCQRCHQRCAKHVKEYNKKGGQFGADPFWQKMRKKHGKDWKIIFNNGLGNQR*
Ga0114999_10011366103300009786MarineMAEKVKIDSGQTKIGSKIIDIHQSNEYTKVNSYKEGMCFGCFDHGVPVGAGVSDICGDCAGKKGRETILVPIKEIVYGMCHFCGEYKHGMEQINARLCQKCHRKVSNVMKAYNNKGGMFEVDPFWKNMRRKHGKDWQIIMSKNLGNKR*
Ga0123376_116654313300010129MarineMATKLDVNTGGTKLGDKIWDIHQKNEYTKVNEYKEGMCFNCFKTGIPVGAGVNDICGDCAGKRGRETILVPIKGVYYGMCHFCGKYKFNMEQVNVRLCQRCHQRCAKHVKEYNKKGGQFGADPFWQKM
Ga0098049_110956833300010149MarineMAEKLKIDSGESKIGSKIVDIHQKNEYTKVNHYKEGMCFSCFGNGIPVGAGVNDICGDCAGKKGRETILVPIKEVVYGMCHFCGVYKHGLEQVNVRLCEKCHRKVANVMKAYNKKGGMFEVDPFWKNMR
Ga0098061_100133983300010151MarineMATKLNLDSGGTDIGNKIVDIHQKNEYTAVNNYKEGLCFGCFGNNVVGALVADICGDCAGKKGREPLLVSIKPIYYGMCHFCGVYKFNMERINCRLCKKCHRRTANHMKEYNKKGGMHGADPFWQSMRKKHGKDWKQIMNNGTKSYRQ*
Ga0098059_100298793300010153MarineVAEKIKIDSGESKIGSKIVDIHQKNEYTRVNNYKEGMCFSCFGNGIPVGAGVNDICGDCAGKKGRETILVPIKEIVYGMCHFCGIYKHGMEQVNVRLCEKCHRKVANIMKAYNTKGGMFEVDPFWKNMRRKHGKDWQIIMSKNLGNKR*
Ga0129342_100020953300010299Freshwater To Marine Saline GradientMATKLDVNIGNTDLGKKIWDIHQNNEYTKVNNYKEGMCYNCFENNAVAALVLDICGDCAGKRGRETILVPIKQIYYGMCYFCGDYKFNLEQINGRLCTKCHRRCATHIKDYNKKGGQFGADPFWKSVKRRHGQDWKLIMNDPSQSYRR*
Ga0181568_1091713813300018428Salt MarshMATKLDVNTGNTDLGKKIWDIHQNNEYTKVNNYKEGMCYNCFENNAVAALVLDICGDCAGKRGRETILVPIKQVYYGMCYFCGDYKFNLEQINGRLCTKCHRRCANHIKDYNKKGGQFGADPFWKSVKRRHGQDWKLIMNDPSQSYRR
Ga0194113_1004424353300020074Freshwater LakeMTTKLNVNTGQTHMGKKIWEIHQKNEYTKVNNYKEGMCFNCFENNAVSALILDICGDCAGKRGRETILVPIKSVYYGMCYFCGNYKFNMEQINARLCHKCHKKVAKVMRAYNKKGGMFNADPFWVRQRKKNGKDWRIIFGQGLGNSR
Ga0194110_1013102013300020084Freshwater LakeMTTKLNVNTGQTHMGKKIWEIHQKNEYTKVNNYKEGMCFNCFENNAVSALILDICGDCAGKRGRETILVPIKSVYYGMCYFCGNYKFNMEQINARLCHKCHKKVAKVMRAYNKKGGMFNADPFWVRQRKKNGKDWRIIFGQGLGNS
Ga0194110_1039126933300020084Freshwater LakeEYTKVNNYKEGMCFNCFSTNAVAAVVSDVCGECAGKRGRETILVPIKQVPYGMCHFCGLYKFNMEQINCRLCHRCHRRVADHMKAYNKKGGMFGADPFWVNQRKKNGKDWKTIFQNGLGNPR
Ga0194131_1008455813300020193Freshwater LakeMATKLNINDGGTHIGKKIWQIHQRNEYTKVNNYKEGMCFNCFSTNAVAAVVSDVCGECAGKRGRETILVPIKQVPYGMCHFCGLYKFNMEQINCRLCHRCHRRVADHMKAYNKKGGMFGADPFWVNQRKKNGKDWKTIFQNGLGNPR
Ga0194127_1009922853300020221Freshwater LakeLNVNTGQTHMGKKIWEIHQKNEYTKVNNYKEGMCFNCFENNAVSALILDICGDCAGKRGRETILVPIKSVYYGMCYFCGNYKFNMEQINARLCHKCHKKVAKVMRAYNKKGGMFNADPFWVRQRKKNGKDWRIIFGQGLGNSR
Ga0211554_1021236323300020431MarineSKIGSKIVDIHQKNEYTKVNNYKEGMCFGCFGNGIPVGAGVNDICGDCAGKKGRETILVPIKEVVYGMCHFCGVYKHGMEQVNVRLCEKCHRKVSNIMKSYNAKGGMFEVDPFWKNMRRKHGKDWQIIMSKNLGNKR
Ga0211503_10005068113300020478MarineMATKLDVNTGGTDLGKKIWEVHQKNEETRVNNYKEAVCFGCLKNDAAGAGVFDICGDCAGKRGREPLLVSIKPVYYGLCYFCGKYKFNMEQINARLCKRCHEKVAKVMKNYNKQGGQFGADPFWQKQRKKHGKDWKIIFSQGLGNSR
Ga0211503_1008118023300020478MarineMPTKLDVNTGNTDLGKKIWEIHQKNEETHVNAYKEAVCFGCLKNDAAGAGIFDICGDCAGKRGREALLVSVKPVYYGLCYFCGEYKFNMEQINVRLCKRCHERVAKIMKKYNQQGGQFGSDPFWQRMRKKHGKDWKIIMSKGLGNKR
Ga0206678_1029364113300021084SeawaterVAEKVKINSGQTKIGSKIVDIHQKNEYTRVNNYKEGMCFSCFGNGIPVGAGVNDICGDCAGKKGRETILVPIKEIVYGMCHFCGEYKHGMEQINARLCQKCHRKVSNIMKSYNAKGGMFEVDPFWK
Ga0206683_1026483013300021087SeawaterVAEKVKINSGQTKIGSKIVDIHQKNEYTRVNNYKEGMCFSCFGNGIPVGAGVNDICGDCAGKKGRETILVPIKEVVYGMCHFCGVYKHGMEQVNVRLCEKCHRKVAKIMKAYNTKGGMFEVDPFWKNMRRKHGKDWQIIMSKNLGNKR
Ga0222717_1021500023300021957Estuarine WaterMAEKLKIDSGESKIGSKIVDIHQKNEYTKVNNYKEGMCFSCFGNGIPVGAGVNDICGDCAGKKGRETILVPIKEVVYGMCHFCGVYKHGMEQVNVRLCEKCHRKVAKIMKAYNTKGGMFEVDPFWKNMRRKHGKDWQIIMSKNLGNKR
Ga0196909_10181113300022043AqueousMATKLDVNTGNTDLGKKIWDIHQNNEYTKVNNYKEGMCYNCFENNAVAALVLDICGDCAGKRGRETILVPIKQIYYGMCYFCGDYKFNLEQINGRLCTKCHRRCATHIKDYNKKGGQFGADPFWKSVKRRHGQDWKLIMNDPSQSYRR
Ga0212029_104299023300022063AqueousGNTDLGKKIWDIHQNNEYTKVNNYKEGMCYNCFENNAVAALVLDICGDCAGKRGRETILVPIKQIYYGMCYFCGDYKFNLEQINGRLCTKCHRRCATHIKDYNKKGGQFGADPFWKSVKRRHGQDWKLIMNDPSQSYRR
Ga0212024_100497833300022065AqueousMPTELDVNTGGTDLGNKIWDIHQSSEYTKVNNYKEGMCYNCFGNNAVAALVLDICGDCAGTRGRETILVPIKSVYYGLCFFCGKHKFNLEQINGRLCHKCHRRCANHIKEYNKKGGQFGADPFWQRMRKKHGKDWKVIFDNGLANPR
Ga0212021_103559233300022068AqueousKIWDIHQSSEYTKVNNYKEGMCYNCFGNNAVAALVLDICGDCAGTRGRETILVPIKSVYYGLCFFCGKHKFNLEQINGRLCHKCHRRCANHIKEYNKKGGQFGADPFWQRMRKKHGKDWKVIFDNGLANPR
(restricted) Ga0233433_1003268513300022931SeawaterVAEKVKIDSGQTKIGSKIVDIHQKNEYTRVNNYKEGMCFSCFGNGIPVGAGVNDICGDCAGKKGRETILVPIKEIVYGMCHFCGEYKHGMEQINARLCQKCHRKVSNIMKSYNAKGGMFEVDPFWKSMRRKHGKDW
(restricted) Ga0233433_1015006423300022931SeawaterMATKLNLDSGGTDIGNKIVDIHQKNEYTKVNNYKEGLCFGCFGSNVVGALVSDICGDCAGKKGREPLLVSIKPIYYGMCHFCGVYKFNMEQINCRLCQKCHRKTANHMKEYNKVGGMHGADPFWKSMRRKHGKDWKQIMSSGTKSWRR
(restricted) Ga0233427_1002000353300022933SeawaterVAEKVKIDSGQTKIGSKIVDIHQKNEYTRVNNYKEGMCFSCFGNGIPVGAGVNDICGDCAGKKGRETILVPIKEIVYGMCHFCGEYKHGMEQINARLCQKCHRKVSNIMKSYNAKGGMFEVDPFWKSMRRKHGKDWQHILGKNLGNKR
(restricted) Ga0233411_1003622133300023112SeawaterVAEKVKIDSGQTKIGSKIIDIHQKNEYTRVNNYKEGMCFSCFGNGIPVGAGVNDICGDCAGKKGRETILVPIKEIVYGMCHFCGEYKHGMEQINARLCQKCHRKVSNIMKLYNAKGGMFEVDPFWKSMRRKHGKDWQHILGKNLGNKR
(restricted) Ga0233424_1038125323300023208FreshwaterHIGKKIVDIHQKNEYTRVNNYKEGLCFGCFENNVVGAVVSDICGNCAGKRGRESILVPIKNVMYGMCHFCGVYRFNMEQINCRLCHKCHRRVADNMKSYNSRGGMFNVDPFWVRQRKKNGKDWREIFTNNMGNKR
(restricted) Ga0233410_1010062323300023276SeawaterVAEKVKIDSGQTKIGSKIVDIHQKNEYTRVNNYKEGMCFSCFGNGIPVGAGVNDICGDCAGKKGRETILVPIKEIVYGMCHFCGEYKHGMEQINARLCQKCHRKVSNIMKLYNAKGGMFEVDPFWKSMRRKHGKDWQHILGKNLGNKR
(restricted) Ga0255040_1027077613300024059SeawaterVAEKVKIDSGQTKIGSKIIDIHQKNEYTRVNNYKEGMCFSCFGNGIPVGAGVNDICGDCAGKKGRETILVPIKEIVYGMCHFCGEYKHGMEQINARLCQKCHRKVSNIMKSYNAKGGMFEVDPFWKNMRRKHGKDWQIIMSKNLGNKR
(restricted) Ga0233438_1034207113300024255SeawaterVAEKVNIDSGQTKIGSKIVDIHQKNEYTRVNNYKEGMCFSCFGNGIPVGAGVNDICGDCAGKKGRETILVPIKEIVYGMCHFCGEYKHGMEQINARLCQKCHRKVSNVMKSYNSKGGMFEVDPFWKSMRRKHGKD
(restricted) Ga0255048_1006902723300024518SeawaterMATKLDLNSGGTDLGKKVIDIHQNNEYTKVNNYKEGLCFGCFGSNVVGALVADICGDCAGKKGREPLLVSIKPVYYGMCHFCGVYKFNMEQVNCRLCQKCHRKTANHMKDYNQKGGMHGADPFWKSMRRKHGKDWKQIMSNGTKSYRQ
(restricted) Ga0255047_1002563433300024520SeawaterMATKLDLNSGGTYLGKKVIDIHQNNEYTKVNNYKEGLCFGCFGSNVVGALVADICGDCAGKKGREPLLVSIKPVYYGMCHFCGVYKFNMEQVNCRLCQKCHRKTANHMKDYNQKGGMHGADPFWKSMRRKHGKDWKQIMSNGTKSYRQ
Ga0208667_100475473300025070MarineMATKLDVNTGGTKLGDKIWDIHQKSEYTKVNEYKEGMCFSCFKTGVPVGAGVNDICGDCAGKKGRETILVPIKGVYYGMCHFCGKYKFNMEQINCRLCQRCHERCAKHIKNYNLKGGQFGADPFWQKMRKKHGKDWKIIFNNGLGNQR
Ga0208791_106468423300025083MarineMAEKLKIDSGESKIGSKIVDIHQKNEYTKVNHYKEGMCFSCFGNGIPVGAGVNDICGDCAGKKGRETILVPIKEVVYGMCHFCGVYKHGLEQVNVRLCEKCHRKVANVMKAYNKKGGMFEVDPFWKNMRRKHGKDWQIIMSKNLGNKR
Ga0208792_106719113300025085MarineMAEKLKIDSGESKIGSKIVDIHQKNEYTKVNHYKEGMCFSCFGNGIPVGAGVNDICGDCAGKKGRETILVPIKEVVYGMCHFCGVYKHGLEQVNVRLCEKCHRKVANVMKVYNKKGGMFEVDPFWKNMRRKHGKDWQIIMSKNLGNKR
Ga0208434_106936913300025098MarineMATKLDVNTGNTYLGKKIWETHQKNEETHVNEYKEATCFGCLKSDAAAAGVFDICGDCAGKRGRETLLVSIKGVYYGICYFCGEHKFNMEQINARLCRRCSRKVADVIKDYNKKGGQFGADPFWIRMRKKHGKDWKVAFNGNGTINSR
Ga0208669_100664553300025099MarineMAEKLKIDSGESKIGSKIVDIHQKNEYTKVNHYKEGMCFSCFGNGIPVGAGVNDICGDCAGKKGRETILVPIKEVVYGMCHFCGVYKHGLEQVNVRLCEKCHRKVSNIMKAYNKKGGMFEVDPFWKNMRRKHGKDWQIIMSKNLGNKR
Ga0208669_101289313300025099MarineMAEKLKIDSGESKIGSKIVDIHQKNEYTKVNHYKEGMCFSCFGNGIPVGAGVNDICGDCAGKKGRETILVPIKEVVYGMCHFCGVYKHGLEQVNVRLCEKCHRKVANVMKAYNKKGGMFEVDPFWKNMRRKHGKDWQIIMSKNLG
Ga0208013_104395433300025103MarineMAEKLKIDSGESKIGSKIVDIHQKNEYTKVNHYKEGMCFSCFGNGIPVGAGVNDICGDCAGKKGRETILVPIKEVVYGMCHFCGVYKHGLEQVNVRLCEKCHRKVANVMKVYNKKGGMFEVDPFWKNMRRKHGKDWQIIMSKNLG
Ga0208013_107438013300025103MarineMATKLNLDGGKTNLGKKIVDIHQENEYTHVDNYKEGLCFGCFTKNVVGALVLDCCGNCAGKRGRETLLVKIKDVYYGMCYFCGKYEFNLEQINARLCRKCHRRVADVMKDYNKKGGQFGADPFWVRQRKKNGKDWKQIFSKNLGNNR
Ga0208433_100495963300025114MarineMATKLNLDSGGTDIGNKIVDIHQKNEYTAVNNYKEGLCFGCFGNNVVGALVADICGDCAGKKGREPLLVSIKPIYYGMCHFCGVYKFNMEQINCRLCKKCHRRTANHMKEYNKKGGMHGADPFWQSMRKKHGKDWKQIMNNGTKSYRQ
Ga0208790_103036823300025118MarineMATKLDVNHGDTDIGKKIWDIHQDNEYTKVNNYKEAVCFGCLKNDAAAAMVADICGECAGKRGRETLLVSIKPVYYGLCYFCGHYKFNMEQINCRLCRTCSRRVANVMKDYNKKGGFQGADPFWQRIKKKHGKDWKQIMNNGTKSYRQ
Ga0208919_109204313300025128MarineMAEKLKIDSGESKIGSKIVDIHQKNEYTKVNHYKEGMCFSCFGNGIPVGAGVNDICGDCAGKKGRETILVPIKEVVYGMCHFCGVYKHGLEQVNVRLCEKCHRKVSNIMKAYNKKGGMFE
Ga0208919_112537813300025128MarineMKHYRGXSWLATKLDVNHGQTYLGKKIWETHQKNEETHVNNYKEAVCFGCLRNDAAGAGIFDICGNCAGKRGRETLLVTIKPVYYGICYFCGEHKFNMEQINARLCRKCSRGVADNIKEYNKKGGQFGADPFWIRMRKKHGKDWRAAFSGNGTINKR
Ga0209337_107387433300025168MarineVAEKVKIDSGASKIGSKIVDIHQKNEYTRVNNYKEGMCFSCFGNGIPVGAGVNDICGDCAGKKGRETILVPIKEIVYGMCHFCGEYKHGMEQINARLCQKCHKKVSNIMKSYNAKGGMFEVDPFWKSMRRKHGKDWQHILGKNLGNKR
Ga0208004_100722073300025630AqueousMPTELDVNTGGTDLGNKIWDIHQSSEYTKVNNYKEGMCYNCFGNNAVAALVLDICGDCAGTRGRETILVPIKSVYYGLCFFCGKHKFNLEQINGRLCHKCHRKCANHIKEYNKKGGQFGADPFWQRMRKKHGKDWKVIFDNGLANPR
Ga0208004_112194123300025630AqueousMATKLDVNTGNTDLGKKIWDIHQNNEYTKVNNYKEGMCYNCFESNAVAALVLDICGDCAGKRGRETILVPIKQVYYGMCYFCGDYKFNLEQINGRLCTKCHKRCANHIKDYNKKGGQFGADPFWKSVKRRHGQDWKLIMNDPSQSYR
Ga0208134_104797213300025652AqueousMAEKLKIDSGESKIGSKIVDIHQKNEYTKVNNYKEGMCFGCFGNGIPVGAGVNDICGDCAGKKGRETILVPIKEVVYGMCHFCGVYKHGMEQVNVRLCEKCHRKVSNIMKSYNAKGGMFEVDPFWKNMRRKHGKDWQIIMSKNLGN
Ga0208898_115356723300025671AqueousMATKLDVNVGNTDLGKKIWKIHQDNEYTKVNNYKEGMCYNCFESNAVAALVLDICGDCAGKRGRETILVPIKQVYYGMCYFCGDYKFNLEQINGRLCTKCHRRCATHIKDYNKKGGQFGADPFWKSVKRRHGQDWKLIMNDPSQSYRR
Ga0208899_100411033300025759AqueousMATKLDVNTGNTDLGKKIWDIHQNNEYTKVNNYKEGMCYNCFESNAVAALVLDICGDCAGKRGRETILVPIKQVYYGMCYFCGDYKFNLEQINGRLCTKCHKRCANHIKDYNKKGGQFGADPFWKSVKRRHGQDWKLIMNDPSQSYRR
Ga0209757_1021833513300025873MarineMATKLDLNSGGTDIGKKVIDIHQKNEYTHVNNYKEGICFGCFGNNVVGALVADICGDCAGKKGREPLLVSIKPVYYGMCHFCGIYKFNMEQVNCRLCQKCHRKTANHMKEYNKVGGMHGADPFWKSMRRKHGKDWKQIMTNGTKSYRK
Ga0208644_102518523300025889AqueousMATKLDVNVGNTDLGKKIWDIHQNNEYTKVNNYKEGMCYNCFENNAVAALVLDICGDCAGKRGRETILVPIKQVYYGMCYFCGDYKFNLEQINGRLCTKCHKRCATHIKEYNKKGGQFGADPFWKSVKRRHGQDWKLIMNDPSQSYRR
Ga0208748_113430023300026079MarineMATKLNLNAGSTAMGKKIVDIHQKNEYTHVNNYKEGMCFGCFGSNVVGAMVADVCGDCAGKRGRETLLVSVKSVYYGMCHFCGDYKFNMEQINCRLCQKCHIRNARHMKSYNKKGGMYGADPFWVSQRRKLGKDYKQIMSSGTKSWRK
Ga0207989_116373113300026209MarineMATKLNLDSGGTDIGNKIVDIHQKNEYTAVNNYKEGLCFGCFGNNVVGALVADICGDCAGKKGREPLLVSIKPIYYGMCHFCGVYKFNMEQINCRLCKKCHRRTANHMKEYNKKGGMHGADPFWQSM
Ga0208879_108750143300026253MarineVDIHQKNEYTHVNNYKEGMCFGCFGSNVVGAMVADVCGDCAGKRGRETLLVSVKSVYYGMCHFCGDYKFNMEQINCRLCQKCHIRNARHMKSYNKKGGMYGADPFWVSQRRKLGKDYKQIMSSGTKSWRK
Ga0207991_102811953300026264MarineMATKLDLNSGGTDIGNKIIEIHQRNEYTAVNNYKEGLCFGCFGSNVVGALVADICGDCAGKKGREPLLVSIKPIYYGMCHFCGIYKFNMEQINCRLCFKCHRRTANHMKDYNKKGGMHGADPFWKSMRRKHGKDWKQIMSNGTKSWRQ
Ga0208942_1001684133300027627Freshwater LenticMTTKLDVNVGTTDVGKKIWDIHQKNEYTKVNNYKEAMCFGCFTTDAAAALVADICGDCASKKGRETLLVSIKPVIYGLCHFCGIYKFNMEQMNIRLCFNCHKKVANIMKNFNKQGGMFNVDPFWKKMRIKHGKDWQHQFNNNTGNNR
Ga0208942_100288953300027627Freshwater LenticMATKLDVNVGQSDIGKKIWSIHQKNEWTKVNNYKEAVCFSCLKSDAAAALVVDICGDCAGKRGRESILVPIKEVYHGLCYFCGTYKFHMEQINCRLCHPCHKRVANVMTAYNKKGGLFGADPFWVKQRKKYGKDWKLMFSGNGGNPR
Ga0209709_1003745533300027779MarineMAEKFEVKTGGTKIGDKIVDIHQKNEYTRVNNYKEGMCFGCFGNGIPVGAGVSDICGDCAGKKGRETILVPIKEIIYGLCHFCGEFKHHLEQINARLCQKCHRRVSNHMKSYNLKGGMLETDPFWKSQRRKHGKDWAHIMSKDLGNPR
Ga0209709_1007357833300027779MarineMAESLKIDSGKTKIGNKIIDIHQSNEYTKVNNYKEGMCFGCFGNGIAVGAGVNDICGDCAGKKGRETILVPIKEVIYGMCHFCGVYKHNLEQVNVRLCQKCHKKVSNIMKSYNKKGGMFEVDPFWKSMRRKHGKDWQHVLGKNLGNSR
Ga0209709_1008024433300027779MarineMAEKVKIESGGTKIGSKIVDIHQKNEYTRVNDYKEGMCFGCFGHGIPVGAGVSDICGDCAGKKGRETILVPIKEIVYGMCHFCGDFKHGLEQINARLCIKCTRRVSNHFKNYNRNGGMLETDPFWKSQRRKHGKDWAHIMSKDLGNPR
Ga0209709_1012554533300027779MarineMAEKVKIDSGQTKIGSKIIDIHQSNEYTRVNSYKEGMCFGCFGNGIPVGAGVSDICGDCAGKKGRETILVPIKEIVYGMCHFCGEYKHGMEQINARLCQKCHRKVSNVMKAYNQKGGMFEVDPFWKNMRRKHGKDWQIIMSKNLGNKR
Ga0209091_1000794963300027801MarineMAESLKIDSGKTKIGNKIIDIHQSNEYTKVNNYKEGMCFGCFGNGIAVGAGVNDICGDCAGKKGRETILVPIKEVIYGMCHFCGVYKHNLEQVNVRLCQKCHKKVSNIMKSYNKKGGMFEVDPFWKSMRRKHGKDWQHVMGKNLGNSR
Ga0209090_1005709123300027813MarineMAEKVNLDSGGTKIGKKIIDIHQSNEYTKVNDYKEGLCFGCFDNGVAVGAGVVDICGDCAGKKGREAILVPIKEVYYGLCYFCGGYKFHMEQVNARLCQKCHRRVSNVMKAFNKKGGMYAVDPFWKNMRRKHGKDWQQIMSQGLGNRR
Ga0209090_1052873223300027813MarineMAESLKIDSGKTKIGNKIIDIHQSNEYTKVNNYKEGMCFGCFGNGIAVGAGVNDICGDCAGKKGRETILVPIKEVIYGMCHFCGVYKHNLEQVNVRLCQKCHKKVSNIMKSYNKKGGMFEVDPFWKSMRRKHGKDWQ
Ga0209035_1004257633300027827MarineVAEKVKIDSGASKIGSKIVDIHQKNEYTRVNNYKEGMCFSCFGNGIPVGAGVNDICGDCAGKKGRETILVPIKEIVYGMCHFCGEYKHGMEQINARLCQKCHRKVSNIMKSYNAKGGMFEVDPFWKSMRRKHGKDWQHILGKNLGNKR
Ga0209089_10006569103300027838MarineMAEKVKIDSGQTKIGSKIIDIHQSNEYTKVNSYKEGMCFGCFDHGVPVGAGVSDICGDCAGKKGRETILVPIKEIVYGMCHFCGEYKHGMEQINARLCQKCHRKVSNVMKAYNNKGGMFEVDPFWKNMRRKHGKDWQIIMSKNLGNRR
(restricted) Ga0233415_1040814523300027861SeawaterMAEKLKIDSGESKIGSKIVDIHQKNEYTKVNHYKEGMCFSCFGNGIPVGAGVNDICGDCAGKKGRETILVPIKEVVYGMCHFCGVYKHGMEQVNVRLCEKCHRKVANIMKAYNTKGGMFEVDPF
(restricted) Ga0233413_1003697923300027996SeawaterMSKKDGKQGQIMAEKLKIDSGESKIGSKIVDIHQKNEYTKVNHYKEGMCFSCFGNGIPVGAGVNDICGDCAGKKGRETILVPIKEVVYGMCHFCGVYKHGMEQVNVRLCEKCHRKVANIMKAYNTKGGMFEVDPFWKNMRRKHGKDWQIIMSKNLGNKR
(restricted) Ga0233414_1005045333300028045SeawaterMMAEKLKIDSGESKIGSKIVDIHQKNEYTKVNHYKEGMCFSCFGNGIPVGAGVNDICGDCAGKKGRETILVPIKEVVYGMCHFCGVYKHGMEQVNVRLCEKCHRKVANIMKAYNTKGGMFEVDPFWKNMRRKHGKDWQIIMSKNLGNKR
(restricted) Ga0233414_1011956513300028045SeawaterIVAEKVKIDSGQTKIGSKIVDIHQKNEYTRVNNYKEGMCFSCFGNGIPVGAGVNDICGDCAGKKGRETILVPIKEIVYGMCHFCGEYKHGMEQINARLCQKCHRKVSNIMKSYNAKGGMFEVDPFWKSMRRKHGKDWQHILGKNLGNKR
Ga0257122_103737453300028177MarineYLGKKVIDIHQNNEYTKVNNYKEGLCFGCFGSNVVGALVADICGDCAGKKGREPLLVSIKPVYYGMCHFCGVYKFNMEQVNCRLCQKCHRKTANHMKDYNQKGGMHGADPFWKSMRRKHGKDWKQIMSNGTKSYRQ
Ga0308021_1001798013300031141MarineYTRVNSYKEGMCFSCFGHGIPVGAGVNDICGDCAGKKGRETILVPIKEIVYGMCHFCGEYKHGLEQVNARLCQKCHRRVSNVMKSYNSKGGMFEVDPFWKSMRRKHGKDWQHIMGKNLGNKR
Ga0308021_1005925833300031141MarineMAEKFEVKTGGTKIGDKIVDIHQKNEYTRVNNYKEGMCFGCFGHGIPVGAGVSDICGDCAGKKGRETILVPIKEIVYGLCHFCGEFKHGLEQINARLCQKCHRRVSNHMKSYNLKGGMLETDPFWKSQRRKHGKDWAHIMSKDLGNPR
Ga0308022_102350123300031142MarineMAEKFEVKTGGTKIGDKIVDIHQKNEYTRVNNYKEGMCFGCFGHGIPVGAGVSDICGDCAGKKGRETILVPIKEIVYGLCHFCGEFKHGLEQINARLCQKCHRRVSNHMKSYNLKGGMLETDPFWKSQRRKHGKDWAHIMSRDLGNPR
Ga0308022_105409423300031142MarineMAENVKIDSGGTKIGNKIIDIHQSNEYTRVNSYKEGMCFSCFGHGIPVGAGVNDICGDCAGKKGRETILVPIKEIVYGMCHFCGEYKHGLEQVNARLCQKCHRRVSNVMKSYNSKGGMFEVDPFWKSMRRKHGKDWQHIMGKNLGNKR
Ga0308022_107788333300031142MarineMAEKFEVKTGGTKIGDKIVDIHQKNEYTRVNNYKEGMCFGCFGNGIPVGAGVSDICGDCAGKKGRETILVPIKEIIYGLCHFCGEFKHHLEQINARLCQKCHRRVSNHMKSYNLKGGMLETDP
Ga0308025_102164413300031143MarineMAESLKIDAGKTKIGNKIIDIHQSNEYTKVNDYKEGMCFGCFGNGIPVGAGVNEICGDCAGKKGRETILVPIKEVIYGMCHFCGVYKHSLEQVNVRLCQKCHKKVSNIMKSYNQKGGMFKVDPFWKSMRRKHGKDWQHVLGKNLGNSR
Ga0308025_110269713300031143MarineMAEKVKLDSGGTKIGNKIIDIHQKNEYTKVNNYKEGMCFGCFDHGVPVGAGVSDICGDCAGKKGRETILVPIKEIVYGMCHFCGEYKHGLEQVNARLCQKCHRRVSNNMRDYNRKGGMMKVDPFWKSMRRKHGKDWQHIMNKDLGNRR
Ga0308023_103916213300031167MarineMAEKFEVKTGGTKIGDKIVDIHQKNEYTRVNNYKEGMCFGCFGNGIPVGAGVSDICGDCAGKKGRETILVPIKEIIYGLCHFCGEFKHHLEQINARLCQKCHRRVSNHMKSYNLKGGMLETD
Ga0308010_120174523300031510MarineNKIIDIHQSNEYTRVNSYKEGMCFSCFGHGIPVGAGVNDICGDCAGKKGRETILVPIKEIVYGMCHFCGEYKHGLEQVNARLCQKCHRRVSNVMKSYNSKGGMFEVDPFWKSMRRKHGKDWQHIMGKNLGNKR
Ga0308010_121891723300031510MarineTKVNNYKEGMCFGCFGNGIPVGAGVNEICGDCAGKKGRETILVPIKEVIYGMCHFCGVYKHSLEQVNVRLCQKCHKKVSNIMKSYNQKGGMFKVDPFWKSMRRKHGKDWQHVLGKNLGNS
Ga0307488_1070781013300031519Sackhole BrineMAEKVKIESGGTKIGSKIVDIHQKNEYTRVNDYKEGMCFGCFGHGIPVGAGVSDICGDCAGKKGRETILVPIKEIVYGMCHFCGDFKHGLEQINARLCIKCTRRVSNHFKNYNRNGGMLETDPFWKSQRRKHGKDWAHI
Ga0308019_1000903983300031598MarineMAESLKIDSGKTKIGNKIIDIHQSNEYTKVNDYKEGMCFGCFGNGIPVGAGVNEICGDCAGKKGRETILVPIKEVIYGMCHFCGVYKHSLEQVNVRLCQKCHKKVSNIMKSYNQKGGMFKVDPFWKSMRRKHGKDWQHVLGKNLGNSR
Ga0307999_103303633300031608MarineMAEKFEVKTGGTKIGDKIVDIHQKNEYTRVNNYKEGMCFGCFGNGIPVGAGVNEICGDCAGKKGRETILVPIKEVIYGMCHFCGVYKHSLEQVNVRLCQKCHKKVSNIMKSYNQKGGMFKVDPFWKSMRRKHGKDWQHVLGKNLGNSR
Ga0308014_100307083300031628MarineMAEKFEVKTGGTKIGDKIVDIHQKNEYTRVNNYKEGMCFGCFGHGIPVGAGVSDICGDCAGKKGRETILVPIKEIVYGLCHFCGEFKHGLEQINARLCIKCTRRVSNHFKNYNKNGGMLETDPFWKSQRRKHGKDWAHIMSKDLGNPR
Ga0308014_100433013300031628MarineIGNKIIDIHQKNEYTKVNNYKEGMCFGCFDHGVPVGAGVSDICGDCAGKKGRETILVPIKEIVYGMCHFCGEYKHGLEQVNARLCQKCHRRVSNNMRDYNRKGGMMKVDPFWKSMRRKHGKDWQHIMNKDLGNRR
Ga0308014_109870113300031628MarineQSNEYTKVNDYKEGMCFGCFGNGIPVGAGVNEICGDCAGKKGRETILVPIKEVIYGMCHFCGVYKHSLEQVNVRLCQKCHKKVSNIMKSYNQKGGMFKVDPFWKSMRRKHGKDWQHVLGKNLGNSR
Ga0308018_1003249833300031655MarineMAEKFEVKTGGTKIGDKIVDIHQKNEYTRVNNYKEGMCFGCFGHGIPVGAGVSDICGDCAGKKGRETILVPIKEIIYGLCHFCGEFKHHLEQINARLCQKCHRRVSNHMKSYNLKGGMLETDPFWKSQRRKHGKDWAHIMSKDLGNPR
Ga0308018_1009113533300031655MarineAESLKIDAGKTKIGNKIIDIHQSNEYTKVNDYKEGMCFGCFGNGIPVGAGVNEICGDCAGKKGRETILVPIKEVIYGMCHFCGVYKHSLEQVNVRLCQKCHKKVSNIMKSYNQKGGMFKVDPFWKSMRRKHGKDWQHVLGKNLGNSR
Ga0307984_100431653300031658MarineMAEKVKIESGGTKIGSKIIDIHQKNEYTKVNNYKEGMCFGCFGHGIPVGAGVSDICGDCAGKKGRETILVPIKEIVYGLCHFCGEFRHGLEQINARLCQKCHRRVSNHMKNYNKKGGMLETDPFWKSQRRKHGKDWAHIMSKDLGNPR
Ga0307984_102942713300031658MarineMAEKFEVKTGGTKIGDKIVDIHQKNEYTRVNNYKEGMCFGCFGHGIPVGAGVSDICGDCAGKKGRETILVPIKEIVYGLCHFCGEFKHGLEQINARLCQKCHRRVSNHMKSYNLKGGMLETDPFWKSQRRKHGKDWAHIMS
Ga0308008_100157833300031687MarineMAEKFEVKTGGTKIGDKIVDIHQKNEYTRVNNYKEGMCFGCFGNGIPVGAGVSDICGDCAGKKGRETILVPIKEIVYGLCHFCGEFKHGLEQINARLCQKCHRRVSNHMKSYNLKGGMLETDPFWKSQRRKHGKDWAHIMSKDLGNPR
Ga0308011_1000462613300031688MarineMAEKFEVKTGGTKIGDKIVDIHQKNEYTRVNNYKEGMCFGCFGHGIPVGAGVSDICGDCAGKKGRETILVPIKEIVYGLCHFCGEFKHGLEQINARLCQKCHRRVSNHMKSYNLKGGMLETDPFWKSQRR
Ga0308017_100540913300031689MarineMAEKFEVKTGGTKIGDKIVDIHQKNEYTRVNNYKEGMCFGCFGHGIPVGAGVSDICGDCAGKKGRETILVPIKEIVYGLCHFCGEFKHGLEQINARLCQKCHRRVSNHMKSYNLKGGMLETDPFWKSQRRK
Ga0315328_1011474733300031757SeawaterVAEKVKINSGQTKIGSKIVDIHQKNEYTRVNNYKEGMCFSCFGNGIPVGAGVNDICGDCAGKKGRETILVPIKEIVYGMCHFCGEYKHGMEQINARLCQKCHRKVSNIMKSYNAKGGMFEVDPFWKSMRRKHGKDWQHILGKNLGNKR
Ga0315322_1011640333300031766SeawaterMAEKLKIDSGESKIGSKIVDIHQKNEYTKVNNYKEGMCFSCFGNGIPVGAGVNDICGDCAGKKGRETILVPIKEVVYGMCHFCGVYKHGMEQVNVRLCEKCHRKVANIMKAYNTKGGMFEVDPFWKNMRRKHGKDWQIIMSKNLGNKR
Ga0315326_1023128733300031775SeawaterMAEKLKIDSGESKIGSKIVDIHQKNEYTKVNHYKEGMCFSCFGNGIPVGAGVNDICGDCAGKKGRETILVPIKEVVYGMCHFCGVYKHGMEQVNVRLCEKCHRKVANIMKAYNTKGGMFEVDPFWKNMRRKHGKDWQIIMSKNLGNKR
Ga0315319_1015496413300031861SeawaterMATKLDLNSGGTDIGKKVINIHQKNEYTHVNNYKEGICFGCFGNNVVGALVADICGDCAGKKGREPLLVSIKPVYYGMCHFCGIYKFNMEQVNCRLCQKCHRKTANHMKEYNKVGGMHGADPFWKSMRRKHGKDWKQIMTNGTKS
Ga0315324_1005627213300032019SeawaterMATKLDLNSGGTDIGKKVINIHQKNEYTHVNNYKEGICFGCFGNNVVGALVADICGDCAGKKGREPLLVSIKPVYYGMCHFCGIYKFNMEQVNCRLCQKCHRKTANHMKEYNKVGGMHGADPFWKSMRRKHGKDWKQIMTNGTKSYRQ
Ga0314858_068222_502_8613300033742Sea-Ice BrineVNSYKEGMCFSCFGNGIPVGAGVNDICGDCAGKKGRETILVPIKEIVYGMCHFCGVYKHGMEQINARLCQKCHKKVSNIMKSYNSKGGMFEVDPFWKSMRRKHGKDWQHILGKNLGNSR
Ga0348337_022335_1796_22423300034418AqueousMATKLDVNTGNTDLGKKIWDIHQNNEYTKVNNYKEGMCYNCFESNAVAALVLDICGDCAGKRGRETILVPIKQVYYGMCYFCGDYKFNLEQINGRLCTKCHRRCANHIKDYNKKGGQFGADPFWKSVKRRHGQDWKLIMNDPSQSYRR

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.