NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F078153

Metagenome / Metatranscriptome Family F078153

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F078153
Family Type Metagenome / Metatranscriptome
Number of Sequences 116
Average Sequence Length 41 residues
Representative Sequence MGWMLFEAMLALGVMLAVVWWTFRGRAENDDEADADEPDRPQ
Number of Associated Samples 93
Number of Associated Scaffolds 116

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 89.66 %
% of genes near scaffold ends (potentially truncated) 14.66 %
% of genes from short scaffolds (< 2000 bps) 62.07 %
Associated GOLD sequencing projects 82
AlphaFold2 3D model prediction Yes
3D model pTM-score0.45

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (78.448 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere
(10.345 % of family members)
Environment Ontology (ENVO) Unclassified
(37.069 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Plant → Plant rhizosphere
(56.034 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 45.71%    β-sheet: 0.00%    Coil/Unstructured: 54.29%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.45
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 116 Family Scaffolds
PF04379DUF525 37.93
PF00834Ribul_P_3_epim 18.97
PF03562MltA 8.62
PF067253D 8.62
PF12867DinB_2 4.31
PF10017Methyltransf_33 3.45
PF00117GATase 2.59
PF08818DUF1801 2.59
PF00990GGDEF 1.72
PF12697Abhydrolase_6 0.86
PF02913FAD-oxidase_C 0.86
PF05016ParE_toxin 0.86
PF01565FAD_binding_4 0.86
PF00295Glyco_hydro_28 0.86

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 116 Family Scaffolds
COG2967Uncharacterized conserved protein ApaG affecting Mg2+/Co2+ transportInorganic ion transport and metabolism [P] 37.93
COG0036Pentose-5-phosphate-3-epimeraseCarbohydrate transport and metabolism [G] 18.97
COG2821Membrane-bound lytic murein transglycosylaseCell wall/membrane/envelope biogenesis [M] 8.62
COG4430Uncharacterized conserved protein YdeI, YjbR/CyaY-like superfamily, DUF1801 familyFunction unknown [S] 2.59
COG5646Iron-binding protein Fra/YdhG, frataxin family (Fe-S cluster biosynthesis)Posttranslational modification, protein turnover, chaperones [O] 2.59
COG5649Uncharacterized conserved protein, DUF1801 domainFunction unknown [S] 2.59
COG0277FAD/FMN-containing lactate dehydrogenase/glycolate oxidaseEnergy production and conversion [C] 0.86
COG5434PolygalacturonaseCarbohydrate transport and metabolism [G] 0.86

 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms78.45 %
UnclassifiedrootN/A21.55 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300002705|JGI25156J39149_1000063All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales84312Open in IMG/M
3300002705|JGI25156J39149_1017165All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales1380Open in IMG/M
3300002705|JGI25156J39149_1046562All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales581Open in IMG/M
3300003316|rootH1_10017775All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales5967Open in IMG/M
3300003316|rootH1_10017776All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales1634Open in IMG/M
3300003320|rootH2_10007281All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales5399Open in IMG/M
3300003752|Ga0055539_1000303All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales26405Open in IMG/M
3300003761|Ga0055535_1007601All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales2048Open in IMG/M
3300005327|Ga0070658_10035774All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales4000Open in IMG/M
3300005327|Ga0070658_10042701All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales3663Open in IMG/M
3300005327|Ga0070658_10618082All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales939Open in IMG/M
3300005330|Ga0070690_100001384All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales12638Open in IMG/M
3300005337|Ga0070682_100635302All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales848Open in IMG/M
3300005339|Ga0070660_100042187All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales3481Open in IMG/M
3300005339|Ga0070660_100390421All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales1150Open in IMG/M
3300005339|Ga0070660_100913025All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales741Open in IMG/M
3300005364|Ga0070673_100024442All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales4431Open in IMG/M
3300005455|Ga0070663_101254437Not Available653Open in IMG/M
3300005456|Ga0070678_101937369All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales557Open in IMG/M
3300005513|Ga0077120_1033510All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales3408Open in IMG/M
3300005513|Ga0077120_1057104All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales2116Open in IMG/M
3300005519|Ga0077119_10047516All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales2996Open in IMG/M
3300005519|Ga0077119_10106416All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales1511Open in IMG/M
3300005538|Ga0070731_10824780All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales615Open in IMG/M
3300005563|Ga0068855_100002610All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales22210Open in IMG/M
3300005577|Ga0068857_100615335All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales1027Open in IMG/M
3300005616|Ga0068852_101689736All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales656Open in IMG/M
3300009093|Ga0105240_10048660All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales5356Open in IMG/M
3300009093|Ga0105240_10054818All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales4994Open in IMG/M
3300009093|Ga0105240_11074505Not Available857Open in IMG/M
3300009101|Ga0105247_11633170Not Available530Open in IMG/M
3300009551|Ga0105238_11502939All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales702Open in IMG/M
3300009660|Ga0105854_1053559All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales1234Open in IMG/M
3300009709|Ga0116227_10324148All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales1178Open in IMG/M
3300009787|Ga0116226_10159550All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales2346Open in IMG/M
3300010331|Ga0123336_10547323Not Available573Open in IMG/M
3300010371|Ga0134125_12162455Not Available605Open in IMG/M
3300010375|Ga0105239_11004250Not Available959Open in IMG/M
3300010375|Ga0105239_12125110Not Available652Open in IMG/M
3300010877|Ga0126356_10765505All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales746Open in IMG/M
3300012469|Ga0150984_117292753Not Available666Open in IMG/M
3300013105|Ga0157369_11359797All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales723Open in IMG/M
3300013296|Ga0157374_10626410Not Available1087Open in IMG/M
3300013296|Ga0157374_11954371All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales613Open in IMG/M
3300014168|Ga0181534_10654043All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales610Open in IMG/M
3300014968|Ga0157379_10481339All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales1149Open in IMG/M
3300015262|Ga0182007_10078797All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Methylibium1080Open in IMG/M
3300015371|Ga0132258_10615078All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales2729Open in IMG/M
3300016341|Ga0182035_10000633All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales16682Open in IMG/M
3300018037|Ga0187883_10709461Not Available525Open in IMG/M
3300021178|Ga0210408_10474715All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales995Open in IMG/M
3300021403|Ga0210397_10019721All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales4134Open in IMG/M
3300021478|Ga0210402_10515117All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales1111Open in IMG/M
3300021860|Ga0213851_1067922All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales768Open in IMG/M
3300022870|Ga0247782_1002476All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales2634Open in IMG/M
3300025226|Ga0209674_100067All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales253824Open in IMG/M
3300025228|Ga0209672_106752All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria1832Open in IMG/M
3300025230|Ga0209563_110888All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales1306Open in IMG/M
3300025231|Ga0207427_100959All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales12286Open in IMG/M
3300025242|Ga0209258_100459All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales44386Open in IMG/M
3300025246|Ga0209646_1000244All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales55661Open in IMG/M
3300025250|Ga0209026_1064262Not Available514Open in IMG/M
3300025253|Ga0209677_101817All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales8730Open in IMG/M
3300025256|Ga0209759_1001872All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales10432Open in IMG/M
3300025909|Ga0207705_10229040All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales1413Open in IMG/M
3300025909|Ga0207705_10423543Not Available1031Open in IMG/M
3300025909|Ga0207705_10990104Not Available650Open in IMG/M
3300025911|Ga0207654_10172385All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales1406Open in IMG/M
3300025913|Ga0207695_10020855All Organisms → cellular organisms → Bacteria → Proteobacteria7488Open in IMG/M
3300025913|Ga0207695_10433107All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales1199Open in IMG/M
3300025927|Ga0207687_10352162All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales1200Open in IMG/M
3300025932|Ga0207690_10116964Not Available1929Open in IMG/M
3300025932|Ga0207690_11008916All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales692Open in IMG/M
3300025942|Ga0207689_10021600All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales5411Open in IMG/M
3300025949|Ga0207667_10026339All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales6356Open in IMG/M
3300025949|Ga0207667_10102002All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales2960Open in IMG/M
3300025960|Ga0207651_11055216Not Available727Open in IMG/M
3300026023|Ga0207677_10795664Not Available846Open in IMG/M
3300026116|Ga0207674_10177484All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales2082Open in IMG/M
3300026116|Ga0207674_10310870All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales1525Open in IMG/M
3300026118|Ga0207675_100052915All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales3788Open in IMG/M
3300026121|Ga0207683_11509465Not Available620Open in IMG/M
3300027504|Ga0209114_1091336Not Available561Open in IMG/M
3300027817|Ga0209112_10017928Not Available2029Open in IMG/M
3300027860|Ga0209611_10187083All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales1277Open in IMG/M
3300028562|Ga0302151_10000148All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales43475Open in IMG/M
3300028562|Ga0302151_10312645Not Available520Open in IMG/M
3300028565|Ga0302145_10152086Not Available780Open in IMG/M
3300028666|Ga0265336_10000087All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales72636Open in IMG/M
3300028783|Ga0302279_10002894All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales22032Open in IMG/M
3300028789|Ga0302232_10514706All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Aquabacterium → unclassified Aquabacterium → Aquabacterium sp.588Open in IMG/M
3300028813|Ga0302157_10079770All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales2134Open in IMG/M
3300028813|Ga0302157_10298883All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Leptothrix → Leptothrix cholodnii881Open in IMG/M
3300028870|Ga0302254_10028114All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales1979Open in IMG/M
3300029896|Ga0247044_1083542Not Available558Open in IMG/M
3300029945|Ga0311330_10414945All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales1111Open in IMG/M
3300029987|Ga0311334_10524434All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria955Open in IMG/M
3300030000|Ga0311337_10525955Not Available1013Open in IMG/M
3300030010|Ga0302299_10066813All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria2006Open in IMG/M
3300030114|Ga0311333_10778122All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales802Open in IMG/M
3300030294|Ga0311349_10993414All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales787Open in IMG/M
3300030521|Ga0307511_10043501All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales3752Open in IMG/M
3300030524|Ga0311357_10247782All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales1725Open in IMG/M
3300030838|Ga0311335_11151674Not Available556Open in IMG/M
3300031716|Ga0310813_10016940All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales4887Open in IMG/M
3300031730|Ga0307516_10004805All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales16463Open in IMG/M
3300031747|Ga0318502_10000845All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Ideonella → unclassified Ideonella → Ideonella sp. B508-110440Open in IMG/M
3300031902|Ga0302322_101705320All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales771Open in IMG/M
3300031918|Ga0311367_10252789All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales1835Open in IMG/M
3300031918|Ga0311367_11559505All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales → Burkholderiales genera incertae sedis → Aquabacterium → unclassified Aquabacterium → Aquabacterium sp.647Open in IMG/M
3300031939|Ga0308174_11051639All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales692Open in IMG/M
3300032090|Ga0318518_10124534All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales1300Open in IMG/M
3300032261|Ga0306920_103318598All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria600Open in IMG/M
3300032954|Ga0335083_10469743Not Available1059Open in IMG/M
3300034170|Ga0370487_0001647All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Burkholderiales5203Open in IMG/M
3300034170|Ga0370487_0263621All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria580Open in IMG/M


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Corn Rhizosphere10.34%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen8.62%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere7.76%
Arabidopsis RootHost-Associated → Plants → Roots → Epiphytes → Unclassified → Arabidopsis Root6.90%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog6.03%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere6.03%
Arabidopsis RootHost-Associated → Plants → Roots → Endophytes → Unclassified → Arabidopsis Root6.03%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil4.31%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Arabidopsis Rhizosphere2.59%
Sugarcane Root And Bulk SoilHost-Associated → Plants → Rhizome → Unclassified → Unclassified → Sugarcane Root And Bulk Soil2.59%
Host-AssociatedHost-Associated → Plants → Peat Moss → Unclassified → Unclassified → Host-Associated2.59%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil1.72%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil1.72%
Forest SoilEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil1.72%
PalsaEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Palsa1.72%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Miscanthus Rhizosphere1.72%
Miscanthus RhizosphereHost-Associated → Plants → Rhizoplane → Soil → Unclassified → Miscanthus Rhizosphere1.72%
EctomycorrhizaHost-Associated → Plants → Roots → Unclassified → Unclassified → Ectomycorrhiza1.72%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere1.72%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Switchgrass Rhizosphere1.72%
WatershedsEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds0.86%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland0.86%
BogEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Bog0.86%
Glacier ValleyEnvironmental → Aquatic → Freshwater → Ice → Glacier → Glacier Valley0.86%
CryconiteEnvironmental → Aquatic → Freshwater → Ice → Unclassified → Cryconite0.86%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Soil0.86%
Terrestrial SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Terrestrial Soil0.86%
Surface SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Surface Soil0.86%
SoilEnvironmental → Terrestrial → Soil → Unclassified → Agricultural → Soil0.86%
SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Soil0.86%
Permafrost SoilEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Permafrost Soil0.86%
Corn RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Corn Rhizosphere0.86%
Switchgrass RhizosphereEnvironmental → Terrestrial → Soil → Loam → Agricultural Soil → Switchgrass Rhizosphere0.86%
Plant LitterEnvironmental → Terrestrial → Plant Litter → Unclassified → Unclassified → Plant Litter0.86%
Arabidopsis RhizosphereHost-Associated → Plants → Rhizoplane → Unclassified → Unclassified → Arabidopsis Rhizosphere0.86%
Switchgrass RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Switchgrass Rhizosphere0.86%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.86%
Miscanthus RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Miscanthus Rhizosphere0.86%
Corn RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Corn Rhizosphere0.86%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere0.86%
Switchgrass RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Switchgrass Rhizosphere0.86%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere0.86%
Avena Fatua RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Avena Fatua Rhizosphere0.86%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil0.86%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
3300002705Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMSHost-AssociatedOpen in IMG/M
3300003316Sugarcane root Sample L1Host-AssociatedOpen in IMG/M
3300003320Sugarcane root Sample H2Host-AssociatedOpen in IMG/M
3300003752Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2Host-AssociatedOpen in IMG/M
3300003761Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2Host-AssociatedOpen in IMG/M
3300005327Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaGHost-AssociatedOpen in IMG/M
3300005330Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaGEnvironmentalOpen in IMG/M
3300005337Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaGEnvironmentalOpen in IMG/M
3300005339Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaGHost-AssociatedOpen in IMG/M
3300005364Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaGHost-AssociatedOpen in IMG/M
3300005455Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaGHost-AssociatedOpen in IMG/M
3300005456Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaGHost-AssociatedOpen in IMG/M
3300005513Combined assembly of arab plate scrape CL_Cvi (Combined Assembly)Host-AssociatedOpen in IMG/M
3300005519Combined assembly of arab plate scrape CL_Col (Combined Assembly)Host-AssociatedOpen in IMG/M
3300005538Surface soil microbial communities from Centralia Pennsylvania, which are recovering from an underground coalmine fire - Coalmine Soil_Cen03_05102014_R1EnvironmentalOpen in IMG/M
3300005563Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2Host-AssociatedOpen in IMG/M
3300005577Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2Host-AssociatedOpen in IMG/M
3300005616Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2Host-AssociatedOpen in IMG/M
3300009093Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaGHost-AssociatedOpen in IMG/M
3300009101Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaGHost-AssociatedOpen in IMG/M
3300009551Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaGHost-AssociatedOpen in IMG/M
3300009660Permafrost soil microbial communities from the Arctic, to analyse light accelerated degradation of dissolved organic matter (DOM) - Organic soil DNA_2013-058EnvironmentalOpen in IMG/M
3300009709Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fb - Sphagnum magellanicum MGHost-AssociatedOpen in IMG/M
3300009787Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fa - Sphagnum fallax MGHost-AssociatedOpen in IMG/M
3300010331Glacier valley bacterial and archeal communities from Borup Fiord, Nunavut, Canada, to study Microbial Dark Matter (Phase II) - ?SSSS metaGEnvironmentalOpen in IMG/M
3300010371Terrestrial soil microbial communities with excess Nitrogen fertilizer from Kellogg Biological Station, Michigan, USA - KB3-175-1EnvironmentalOpen in IMG/M
3300010375Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaGHost-AssociatedOpen in IMG/M
3300010877Boreal forest soil eukaryotic communities from Alaska, USA - W3-2 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300012469Combined assembly of Soil carbon rhizosphereHost-AssociatedOpen in IMG/M
3300013105Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaGHost-AssociatedOpen in IMG/M
3300013296Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaGHost-AssociatedOpen in IMG/M
3300014168Peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin17_10_metaGEnvironmentalOpen in IMG/M
3300014968Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaGHost-AssociatedOpen in IMG/M
3300015262Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaGHost-AssociatedOpen in IMG/M
3300015371Combined assembly of cpr5 and col0 rhizosphere and soilHost-AssociatedOpen in IMG/M
3300016341Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170EnvironmentalOpen in IMG/M
3300018037Peatland microbial communities from SPRUCE experiment site at the Marcell Experimental Forest, Minnesota, USA - June2016WEW_20_10EnvironmentalOpen in IMG/M
3300021178Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-4-MEnvironmentalOpen in IMG/M
3300021403Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-H-2-OEnvironmentalOpen in IMG/M
3300021478Forest soil microbial communities from Barre Woods Harvard Forest LTER site, Petersham, Massachusetts, United States - Inc-BW-C-7-MEnvironmentalOpen in IMG/M
3300021860Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2014 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022870Plant litter microbial communities from Arlington Agricultural Research Station in Wisconsin, United States - UWRJ-L019-104C-5EnvironmentalOpen in IMG/M
3300025226Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025228Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025230Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025231Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes)Host-AssociatedOpen in IMG/M
3300025242Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025246Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes)Host-AssociatedOpen in IMG/M
3300025250Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes)Host-AssociatedOpen in IMG/M
3300025253Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025256Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes)Host-AssociatedOpen in IMG/M
3300025909Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025911Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025913Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025927Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025932Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300025942Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025949Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300025960Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300026023Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026116Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026118Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes)Host-AssociatedOpen in IMG/M
3300026121Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes)Host-AssociatedOpen in IMG/M
3300027504Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_RefH0_O3 (SPAdes)EnvironmentalOpen in IMG/M
3300027817Forest soil microbial communities from Davy Crockett National Forest, Groveton, Texas, USA - Texas A ecozone_OM3H0_O3 (SPAdes)EnvironmentalOpen in IMG/M
3300027860Host-associated microbial communities from peat moss isolated from Minnesota, USA - S1T2_Fc - Sphagnum magellanicum MG (SPAdes)Host-AssociatedOpen in IMG/M
3300028562Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N1_3EnvironmentalOpen in IMG/M
3300028565Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_E2_3EnvironmentalOpen in IMG/M
3300028666Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaGHost-AssociatedOpen in IMG/M
3300028783Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_N3_3EnvironmentalOpen in IMG/M
3300028789Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Palsa_N2_3EnvironmentalOpen in IMG/M
3300028813Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Bog_N3_3EnvironmentalOpen in IMG/M
3300028870Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - I_Fen_E1_4EnvironmentalOpen in IMG/M
3300029896Cryconite microbial communities from ice sheet in Tasiilaq, Greenland - TAS_L-C3bEnvironmentalOpen in IMG/M
3300029945I_Bog_N2 coassemblyEnvironmentalOpen in IMG/M
3300029987I_Fen_E3 coassemblyEnvironmentalOpen in IMG/M
3300030000I_Fen_N3 coassemblyEnvironmentalOpen in IMG/M
3300030010Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Fen_N3_4EnvironmentalOpen in IMG/M
3300030114I_Fen_E2 coassemblyEnvironmentalOpen in IMG/M
3300030294II_Fen_E3 coassemblyEnvironmentalOpen in IMG/M
3300030521Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EMHost-AssociatedOpen in IMG/M
3300030524II_Palsa_N3 coassemblyEnvironmentalOpen in IMG/M
3300030838I_Fen_N1 coassemblyEnvironmentalOpen in IMG/M
3300031716Soil microbial communities from experimental microcosm in Duke University, North Carolina, United States - YN3EnvironmentalOpen in IMG/M
3300031730Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EMHost-AssociatedOpen in IMG/M
3300031747Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.174b1f22EnvironmentalOpen in IMG/M
3300031902Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - Fen_T0_2EnvironmentalOpen in IMG/M
3300031918III_Fen_N3 coassemblyEnvironmentalOpen in IMG/M
3300031939Soil microbial communities from UC Gill Tract Community Farm, Albany, California, United States - DLSLS.P.R2EnvironmentalOpen in IMG/M
3300032090Tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.SIPMG.176b2f22EnvironmentalOpen in IMG/M
3300032261Lab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - flux4day.12C.oxic.44.000.170 (v2)EnvironmentalOpen in IMG/M
3300032954Soil microbial communities from Loxahatchee National Wildlife Refuge, Florida, United States - Lox_Sample_4.2EnvironmentalOpen in IMG/M
3300034170Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_03D_16EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
JGI25156J39149_1000063213300002705Arabidopsis RootMGWMLFEAMLALGVMLAVVWWTFRGRAENDDDADADEPDRPQ*
JGI25156J39149_101716513300002705Arabidopsis RootMGWIVFEAMLALAAALVVVWWTFRGRADSVDDEADAEER*
JGI25156J39149_104656223300002705Arabidopsis RootMGWIVFEALLALGVMLALVWWTFRGRAETATDEDDVDAP*
rootH1_1001777523300003316Sugarcane Root And Bulk SoilMGWMLFEAMLALGVMLAVVWWTFRGRAEREDDAAEDSADRPQ*
rootH1_1001777623300003316Sugarcane Root And Bulk SoilMGWMLFEAMLALGVMLAVVWWTFRGRAERDEDDTGTPPGRQ*
rootH2_1000728163300003320Sugarcane Root And Bulk SoilMGWMLFEAMLALAALVAAVWWTFRGRVEDDDDPESADRPQ*
Ga0055539_100030373300003752Arabidopsis RootMGWMLFEAMLALGVMLAVVWWTFRGRAERDEDEAEDSADRSQ*
Ga0055535_100760143300003761Arabidopsis RootMGWMLFEAMLALGVMLAVVWWTFRGRAENDDEADADEPDRPQ*
Ga0070658_1003577433300005327Corn RhizosphereMGWIVFEALLALGAMLALVWWTFRGRADTADDETDADRPQ*
Ga0070658_1004270153300005327Corn RhizosphereMGWMLFEAMLALGVVLAVVWWTFRGRAERVEDESDAEETP*
Ga0070658_1061808223300005327Corn RhizosphereMGWIVFEALLALGAMLALVWWTFRGRADTAEDESDPEPPQ*
Ga0070690_10000138473300005330Switchgrass RhizosphereMGWMLFEALLALGVMLAVVWWTFRSRSERVDDETDAEETPGGRQ*
Ga0070682_10063530223300005337Corn RhizosphereMGWMLFEAMLALGVVLAVVWWTFHGRAENDDDAGDAEGPADGRQ*
Ga0070660_10004218733300005339Corn RhizosphereMGWIVFEALLALGVMLALVWWTFRGRADTTVEEDDADAS*
Ga0070660_10039042123300005339Corn RhizosphereMGWMLFEAMLALGVMLAVVWWTFRGRAENDDDTGDAEGPADGRQ*
Ga0070660_10091302533300005339Corn RhizosphereMGWMLFEAMLALGVMLAVVWWTFRGRAENDDEVEVDEPEGPQ*
Ga0070673_10002444233300005364Switchgrass RhizosphereMGWIVFEALLALGVLLALVWWTFRGRADSAADEDDADPS*
Ga0070663_10125443713300005455Corn RhizosphereWMLFEAMLALGVMLAVVWWTFRGRAENDDDAEVDEPEGPQ*
Ga0070678_10193736923300005456Miscanthus RhizosphereMGWMLFEAMLALGVMLAVVWWTFRGRAERVDDEADAEDQ*
Ga0077120_103351023300005513Arabidopsis RhizosphereMGWMVFEAMLALAAVLAIVWWTFRGRSDGDDGEEDA*
Ga0077120_105710433300005513Arabidopsis RhizosphereMGWIVFEALLALGVMLALVWWTFRGRADTAVEEDDADPSQSRH*
Ga0077119_1004751643300005519Arabidopsis RootMGWIVFEAMLALAAMLVAVWWTFRGRAESVDDEAEAEERVER*
Ga0077119_1010641643300005519Arabidopsis RootMGWMAFEALLALFVMLAVVWWTFRGRAGQDDDEPDSEHPADKPQ*
Ga0070731_1082478023300005538Surface SoilMGWIVFEAMLALCVMLAVVWWTFRGRAKPDADEADSEADKPQ*
Ga0068855_10000261063300005563Corn RhizosphereMLFEAMLALGVMLAVVWWTFRGRAENDDDAGDADEPADGRQ*
Ga0068857_10061533533300005577Corn RhizosphereMGWMLFEAMLALGVMLAVVWWTFRGRAENDDDADADEPQ*
Ga0068852_10168973623300005616Corn RhizosphereMGWIVFEALLALGVMLALVWWTFRGRADTAVEEDDADAS*
Ga0105240_1004866043300009093Corn RhizosphereMGWMLFEAMLALGVMLAVVWWTFRGRAERDEDDDSTQ*
Ga0105240_1005481843300009093Corn RhizosphereMGWMLFEAMLALGVVLAVVWWTFRGRADNDDDADADADAPQ*
Ga0105240_1107450523300009093Corn RhizosphereMGWIVFEALLALGVMLALVWWTFRGRADTAVEEDDVDAS*
Ga0105247_1163317013300009101Switchgrass RhizosphereMGWMLFEAMLALGVMLAVVWWTFRGRAENDDDTGDAEGPVDGRQ*
Ga0105238_1150293933300009551Corn RhizosphereFEAMLALGVMLAVVWWTFRGRAENDGDAGDADEPADGRQ*
Ga0105854_105355933300009660Permafrost SoilMGWIVFEAMLALVVMLAVVWWTFRGRADIEADDAEPPADKP*
Ga0116227_1032414823300009709Host-AssociatedMGWILFEAMLALTVAMVVVWWTFRGRAEPDPVDTDDEADS*
Ga0116226_1015955033300009787Host-AssociatedMGWIVFEAMLALAVMLALVWWTFRGRADTDADEPDNDKP*
Ga0123336_1054732313300010331Glacier ValleyMGWIVFEALLALAVMLAVVWWTFRGRADVAEADADAPGDER*
Ga0134125_1216245523300010371Terrestrial SoilMGWIVFEALLALGAMLALVWWTFRGRADTADDESDPDRPQ*
Ga0105239_1100425033300010375Corn RhizosphereMGWIVFEALLALGVMLALVWWTFRGRADSAVDEDDADAS*
Ga0105239_1212511023300010375Corn RhizosphereMGWMLFEAMLALGVMLAVVWWTFRGRAENDGDAGDADEPADGRQ*
Ga0126356_1076550523300010877Boreal Forest SoilMTAKRDLMGWIVFEAMLALAVMLAVVWWTFRGRADTEADDAEPPADKP*
Ga0150984_11729275313300012469Avena Fatua RhizosphereRDLMGWMLFEAMLALAVMLAVVWWTFRGRTDKDDADADEPDR*
Ga0157369_1135979713300013105Corn RhizosphereADRDLMGWMLFEAMLALGVMLAVVWWTFRGRAENDDEVEVDEPEGPQ*
Ga0157374_1062641033300013296Miscanthus RhizosphereMGWMVFEALLALAVMLALVWWTFRGRAETAADEDDADKS*
Ga0157374_1195437123300013296Miscanthus RhizosphereMGWIVFEALLALVVMLALVWWTFRGRAETATDEDDVDPS*
Ga0181534_1065404323300014168BogMGWILFEAMLALAAMLLAVWWTFRGRADGVDDEADADER*
Ga0157379_1048133923300014968Switchgrass RhizosphereMGWMLFEALLALGVMLAVVWWTFRSRSERVDDETDADETPGGRQ*
Ga0182007_1007879713300015262RhizosphereMGWMLFEAKLALAVMLAAVWWTFRGRSERSDEAADAEDGPGEGQ*
Ga0132258_1061507823300015371Arabidopsis RhizosphereMGWMLFEAMLALGVMLAVVWWTFRGRAENDDDTDDAEGPADGRQ*
Ga0182035_10000633153300016341SoilMLFEAMVALGAMVAVVWWTFRGRAGRGDEEADTEETPTGRQ
Ga0187883_1070946113300018037PeatlandKRDLMGWILFEAMLALAVMLVWVWWTFRGRADDIGSDDAEAEPPADKP
Ga0210408_1047471513300021178SoilMGWIVFEAMLALAALLVAVWWTFRGRADSGDDESDAGEG
Ga0210397_1001972143300021403SoilMGWIVFEAMLALCVMLAVVWWTFRGRADDASSPDEPDQDPPADKP
Ga0210402_1051511723300021478SoilMGWIVFEAMLALCVMLAVVWWTFRGRADPDADEPDKDADKP
Ga0213851_106792223300021860WatershedsMGWIVFEALLALTVLLVAVWWTFRGRAESVDADDET
Ga0247782_100247643300022870Plant LitterMGWIVFEALLALAVMLAVVWWTFRGRADVADADADAPDDEGSR
Ga0209674_1000671403300025226Arabidopsis RootMGWMLFEAMLALGVMLAVVWWTFRGRAERDEDEAEDSADRSQ
Ga0209672_10675223300025228Arabidopsis RootMGWIVFEAMLALAAALVVVWWTFRGRADSVDDEADAEER
Ga0209563_11088823300025230Arabidopsis RootMGWIVFEALLALGVMLALVWWTFRGRADTAVEEDDADPSQSRH
Ga0207427_100959103300025231Arabidopsis RhizosphereMGWMLFEAMLALGVMLAVVWWTFRGRAERDEDDDSTQ
Ga0209258_100459313300025242Arabidopsis RootMGWMLFEAMLALGVMLAVVWWTFRGRAENDDEADADEPDRPQ
Ga0209646_1000244213300025246Arabidopsis RootMGWMLFEAMLALGVMLAVVWWTFRGRAENDDDADADEPDRPQ
Ga0209026_106426223300025250Arabidopsis RootMGWIVFEAMLALAAMLVAVWWTFRGRAESVDDEAEAEERVER
Ga0209677_10181753300025253Arabidopsis RootMGWMVFEAMLALAAVLAIVWWTFRGRSDGDDGEEDA
Ga0209759_100187273300025256Arabidopsis RootMGWIVFEALLALGVMLALVWWTFRGRAETATDEDDVDAP
Ga0207705_1022904023300025909Corn RhizosphereMGWIVFEALLALGVMLALVWWTFRGRADTTVEEDDADAS
Ga0207705_1042354323300025909Corn RhizosphereMGWMVFEAMLALAAVLAIVWWTFRGRSDGGDDGEEDA
Ga0207705_1099010423300025909Corn RhizosphereMGWMLFEAMLALGVVLAVVWWTFRGRAERVEDESDAEETP
Ga0207654_1017238523300025911Corn RhizosphereMGWMLFEAMLALGVMLAVVWWTFRGRAENDDEVEVDEPEGPQ
Ga0207695_1002085543300025913Corn RhizosphereMGWMLFEAMLALGVVLAVVWWTFRGRADNDDDADADADAPQ
Ga0207695_1043310723300025913Corn RhizosphereMGWMLFEAMLALGVMLAVVWWTFRGRAENDDEEEVDEPEG
Ga0207687_1035216223300025927Miscanthus RhizosphereMGWMLFEAMLALGVMLAVVWWTFRGRAENDDDAGDAEGPVDGRQ
Ga0207690_1011696423300025932Corn RhizosphereMGWMLFEAMLALGVMLAVVWWTFRGRAENDDDTGDAEGPADGRQ
Ga0207690_1100891613300025932Corn RhizosphereMGWMVFEAMLALAAVLAIVWWTFRGRSDDAEDDETQ
Ga0207689_1002160023300025942Miscanthus RhizosphereMLFEALLALGVMLAVVWWTFRSRSERVDDETDAEETPGGRQ
Ga0207667_1002633943300025949Corn RhizosphereMLFEAMLALGVMLAVVWWTFRGRAENDDDAGDADEPADGRQ
Ga0207667_1010200223300025949Corn RhizosphereMLFEAMLALGVMLAVVWWTFRGRAENDDGADADEPDRPQ
Ga0207651_1105521623300025960Switchgrass RhizosphereMGWIVFEALLALGVMLALVWWTFRGRADTAVEEDDADAS
Ga0207677_1079566433300026023Miscanthus RhizosphereDLMGWMLFEALLALGVMLAVVWWTFRSRSERVDDETDAEETPGGRQ
Ga0207674_1017748433300026116Corn RhizosphereMGWMLFEAMLALGVMLAVVWWTFRGRAENDDDADADEPQ
Ga0207674_1031087023300026116Corn RhizosphereMLFEAMLALGVMLAVVWWTFRGRAENDDDTGDAEGPADGRQ
Ga0207675_10005291543300026118Switchgrass RhizosphereMGWMLFEALLALGVMLAVVWWTFRSRSERVDDETDAEETPGGRQ
Ga0207683_1150946523300026121Miscanthus RhizosphereMGWMLFEAMLALGVMLAVVWWTFRGRAERVDDEADAEDQ
Ga0209114_109133623300027504Forest SoilMGWIVFEAMLALCVMLAVVWWTFRGRADDDSPDEPEKDVPADKP
Ga0209112_1001792843300027817Forest SoilKRDLMGWIAFEAMLALCVMLAVVWWTFRGRAKPDADEAEQDVDSPQ
Ga0209611_1018708323300027860Host-AssociatedMGWIVFEAMLALAVMLALVWWTFRGRADTGADESDNDKP
Ga0302151_1000014883300028562BogMGWILFEAMLALTVAMVAVWWTFRGRADPDAVDTDADAPGE
Ga0302151_1031264523300028562BogDLMGWILFEAMLALAVMLVWVWWTFRGRADIGSDDAEAEPPADKP
Ga0302145_1015208633300028565BogLMGWILFEAMLALAVMLVWVWWTFRGRADIGSDDAEAEPPADKP
Ga0265336_10000087403300028666RhizosphereMGWIVFEALLALAVMLALVWWTFRGRAEVGADAPDSERADDS
Ga0302279_10002894193300028783BogMGWIVFEAMLALTVMLAVVWWTFRGRTTDTADEPPADESPVDKA
Ga0302232_1051470623300028789PalsaMGWIVFEAMLALCVMLAVVWWTFRGRADPDPDADERDNEADKPQ
Ga0302157_1007977023300028813BogMGWIVFEAMLALAVMLALVWWTFRGRAETGADDGDNDKS
Ga0302157_1029888333300028813BogFEAMLALAVMLVWVWWTFRGRADIGSDDAEAEPPVDKP
Ga0302254_1002811413300028870FenMGWILFEALLALAVMVAAAWWTFRGRREPAVTEPGAGP
Ga0247044_108354223300029896CryconiteMGWIVFEALLALAVMLAVVWWTFRGRADVAEEDADAPGDER
Ga0311330_1041494533300029945BogMGWIVFEAMLALAAMLVAVWWTFRGRADSVDEESDTEER
Ga0311334_1052443423300029987FenMGWIVFEAMLALAVMLAVVWWTFRGRADDEPDEPDADER
Ga0311337_1052595523300030000FenMGWIVFEALLALAVMLAVVWWTFRGRADDEPDEPDEPGADAS
Ga0302299_1006681323300030010FenMGWIVFEAMLALAVMLAVVWWTFRGRADDEPDEPDTDER
Ga0311333_1077812223300030114FenMGWIVFEALLALGVMLALVWWTVRGRSDAQAEDAQPPGDEP
Ga0311349_1099341423300030294FenMGWIVFEALLALAVLLALVWWTVRGRTDDAEDDPPSDRR
Ga0307511_1004350133300030521EctomycorrhizaMGWMAFEALLALLVMLAVVWWTFRGRAGQDDDEPDSEHPADKPQ
Ga0311357_1024778213300030524PalsaMGWILFEAMLALAVMLVWVWWTFRGRADIGSDDAEAEPPADKP
Ga0311335_1115167423300030838FenMGWIVFEALLALAVLLALVWWTVRGRTDDAEDDPPSDRG
Ga0310813_1001694023300031716SoilMGWMLFEAMLALGVMLAVVWWTFRGRAENDDDTDDAEGPADGRQ
Ga0307516_1000480593300031730EctomycorrhizaMGWIVFEALLALAVMLALVWWTFRGRADRDGDEPDTESPTDKR
Ga0318502_1000084523300031747SoilMGWMLFEAMVALGAMVAVVWWTFRGRAGRGDEEADTEETPTGRQ
Ga0302322_10170532013300031902FenRDLMGWIVFEALLALAVLLALVWWTVRGRTDDAEDDPPSDRR
Ga0311367_1025278923300031918FenMGWIVFEALLALAVMLAVVWWTFRGRADAAGDDEDDVDTP
Ga0311367_1155950523300031918FenMGWIVFEAMLALAVLLVAVWWTLRGRADSVDDEADAGEN
Ga0308174_1105163923300031939SoilMGWIVFEALLALGVLLALVWWTFRGRADSAVEEDDADRS
Ga0318518_1012453413300032090SoilGWMLFEAMVALGAMVAVVWWTFRGRAGRGDEEADTEETPTGRQ
Ga0306920_10331859813300032261SoilMGWMLFEAMVALVAMLAVVWWTFRGRAEGGEDDADDRADGRQ
Ga0335083_1046974323300032954SoilMGWIVFEAMLALCVMLAVVWWTFRGRAKSDADEADNEADRPQ
Ga0370487_0001647_1222_13533300034170Untreated Peat SoilMGWIVFEAMLALVVMLALVWWTIRGRADNGSEDADSELPADER
Ga0370487_0263621_2_1183300034170Untreated Peat SoilMGWIVFEALLALSVLLVAVWWTFRGRADGVDDEADAEGR

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.