NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome / Metatranscriptome Family F082866

Metagenome / Metatranscriptome Family F082866

Go to section:
Overview Alignments Structure & Topology Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F082866
Family Type Metagenome / Metatranscriptome
Number of Sequences 113
Average Sequence Length 75 residues
Representative Sequence MHHQLPNRKRTLNLLLRKASGSGKICVLSQIEPQTPRLVVSFRQYLQVSILQSYSPQNPKPSGFPGDASVFARF
Number of Associated Samples 97
Number of Associated Scaffolds 113

Quality Assessment
Transcriptomic Evidence Yes
Most common taxonomic group Eukaryota
% of genes with valid RBS motifs 86.73 %
% of genes near scaffold ends (potentially truncated) 13.27 %
% of genes from short scaffolds (< 2000 bps) 85.84 %
Associated GOLD sequencing projects 97
AlphaFold2 3D model prediction Yes
3D model pTM-score0.25

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Eukaryota (99.115 % of family members)
NCBI Taxonomy ID 2759
Taxonomy All Organisms → cellular organisms → Eukaryota

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland
(11.504 % of family members)
Environment Ontology (ENVO) Unclassified
(26.549 % of family members)
Earth Microbiome Project Ontology (EMPO) Free-living → Non-saline → Water (non-saline)
(51.327 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 27.45%    β-sheet: 0.00%    Coil/Unstructured: 72.55%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  
pTM-score: 0.25
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms99.12 %
UnclassifiedrootN/A0.88 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
3300001242|C687J13896_1004659All Organisms → cellular organisms → Eukaryota4762Open in IMG/M
3300002024|MIS_1178902All Organisms → cellular organisms → Eukaryota1031Open in IMG/M
3300004474|Ga0068968_1007944All Organisms → cellular organisms → Eukaryota → Metamonada → Fornicata → Diplomonadida → Hexamitidae → Hexamitinae → Trepomonas → unclassified Trepomonas → Trepomonas sp. PC11504Open in IMG/M
3300004506|Ga0068973_1012324All Organisms → cellular organisms → Eukaryota991Open in IMG/M
3300004561|Ga0068921_1028539All Organisms → cellular organisms → Eukaryota → Metamonada → Fornicata → Diplomonadida → Hexamitidae → Hexamitinae → Trepomonas → unclassified Trepomonas → Trepomonas sp. PC11112Open in IMG/M
3300004595|Ga0008278_1226288All Organisms → cellular organisms → Eukaryota → Metamonada → Fornicata → Diplomonadida → Hexamitidae → Hexamitinae → Trepomonas → unclassified Trepomonas → Trepomonas sp. PC11133Open in IMG/M
3300004607|Ga0068948_1035575All Organisms → cellular organisms → Eukaryota → Metamonada → Fornicata → Diplomonadida → Hexamitidae → Hexamitinae → Trepomonas → unclassified Trepomonas → Trepomonas sp. PC11232Open in IMG/M
3300004609|Ga0068958_1026527All Organisms → cellular organisms → Eukaryota → Metamonada → Fornicata → Diplomonadida → Hexamitidae → Hexamitinae → Trepomonas → unclassified Trepomonas → Trepomonas sp. PC11061Open in IMG/M
3300004614|Ga0068956_1047845All Organisms → cellular organisms → Eukaryota → Metamonada → Fornicata → Diplomonadida → Hexamitidae → Hexamitinae → Trepomonas → unclassified Trepomonas → Trepomonas sp. PC11123Open in IMG/M
3300006228|Ga0082388_123765All Organisms → cellular organisms → Eukaryota → Metamonada → Fornicata → Diplomonadida → Hexamitidae → Hexamitinae → Trepomonas → unclassified Trepomonas → Trepomonas sp. PC11528Open in IMG/M
3300006231|Ga0082391_131546All Organisms → cellular organisms → Eukaryota → Metamonada → Fornicata → Diplomonadida → Hexamitidae → Hexamitinae → Trepomonas → unclassified Trepomonas → Trepomonas sp. PC11502Open in IMG/M
3300006232|Ga0082392_120172All Organisms → cellular organisms → Eukaryota1472Open in IMG/M
3300006375|Ga0075490_1026772All Organisms → cellular organisms → Eukaryota → Metamonada → Fornicata → Diplomonadida → Hexamitidae → Hexamitinae → Trepomonas → unclassified Trepomonas → Trepomonas sp. PC1515Open in IMG/M
3300006375|Ga0075490_1082094All Organisms → cellular organisms → Eukaryota → Metamonada → Fornicata → Diplomonadida → Hexamitidae → Hexamitinae → Trepomonas → unclassified Trepomonas → Trepomonas sp. PC11127Open in IMG/M
3300006388|Ga0079062_1072010All Organisms → cellular organisms → Eukaryota → Metamonada → Fornicata → Diplomonadida → Hexamitidae → Hexamitinae → Trepomonas → unclassified Trepomonas → Trepomonas sp. PC11396Open in IMG/M
3300006594|Ga0079073_1256350All Organisms → cellular organisms → Eukaryota → Metamonada → Fornicata → Diplomonadida → Hexamitidae → Hexamitinae → Trepomonas → unclassified Trepomonas → Trepomonas sp. PC11166Open in IMG/M
3300006645|Ga0099769_1015452All Organisms → cellular organisms → Eukaryota1115Open in IMG/M
3300007221|Ga0099765_1324148All Organisms → cellular organisms → Eukaryota741Open in IMG/M
3300007244|Ga0075167_11055359All Organisms → cellular organisms → Eukaryota → Metamonada → Fornicata → Diplomonadida → Hexamitidae → Hexamitinae → Trepomonas → unclassified Trepomonas → Trepomonas sp. PC11425Open in IMG/M
3300007248|Ga0075168_1122912All Organisms → cellular organisms → Eukaryota → Metamonada → Fornicata → Diplomonadida → Hexamitidae → Hexamitinae → Trepomonas → unclassified Trepomonas → Trepomonas sp. PC1673Open in IMG/M
3300007253|Ga0075182_11292906All Organisms → cellular organisms → Eukaryota → Metamonada → Fornicata → Diplomonadida → Hexamitidae → Hexamitinae → Trepomonas → unclassified Trepomonas → Trepomonas sp. PC11324Open in IMG/M
3300008569|Ga0103779_100649All Organisms → cellular organisms → Eukaryota → Metamonada → Fornicata → Diplomonadida → Hexamitidae → Hexamitinae → Trepomonas → unclassified Trepomonas → Trepomonas sp. PC11494Open in IMG/M
3300009175|Ga0073936_10371089All Organisms → cellular organisms → Eukaryota → Metamonada → Fornicata → Diplomonadida → Hexamitidae → Hexamitinae → Trepomonas → unclassified Trepomonas → Trepomonas sp. PC1890Open in IMG/M
3300009196|Ga0103745_10007593All Organisms → cellular organisms → Eukaryota → Metamonada → Fornicata → Diplomonadida → Hexamitidae → Hexamitinae → Trepomonas → unclassified Trepomonas → Trepomonas sp. PC11389Open in IMG/M
3300009419|Ga0114982_1138782All Organisms → cellular organisms → Eukaryota → Metamonada → Fornicata → Diplomonadida → Hexamitidae → Hexamitinae → Trepomonas → unclassified Trepomonas → Trepomonas sp. PC1750Open in IMG/M
3300009538|Ga0129287_10129286All Organisms → cellular organisms → Eukaryota → Metamonada → Fornicata → Diplomonadida → Hexamitidae → Hexamitinae → Trepomonas → unclassified Trepomonas → Trepomonas sp. PC11078Open in IMG/M
3300009579|Ga0115599_1079643All Organisms → cellular organisms → Eukaryota → Metamonada → Fornicata → Diplomonadida → Hexamitidae1112Open in IMG/M
3300009579|Ga0115599_1079757All Organisms → cellular organisms → Eukaryota1511Open in IMG/M
3300009580|Ga0115596_1041539All Organisms → cellular organisms → Eukaryota1243Open in IMG/M
3300009581|Ga0115600_1143724All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Fungi incertae sedis → Mucoromycota → Glomeromycotina → Glomeromycetes → Diversisporales → Diversisporaceae → Diversispora → Diversispora epigaea1108Open in IMG/M
3300009583|Ga0115598_1011812All Organisms → cellular organisms → Eukaryota → Metamonada → Fornicata → Diplomonadida → Hexamitidae → Hexamitinae → Trepomonas → unclassified Trepomonas → Trepomonas sp. PC11499Open in IMG/M
3300009583|Ga0115598_1084559All Organisms → cellular organisms → Eukaryota → Metamonada → Fornicata → Diplomonadida → Hexamitidae → Hexamitinae → Trepomonas → unclassified Trepomonas → Trepomonas sp. PC11026Open in IMG/M
3300009583|Ga0115598_1167424All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Fungi incertae sedis → Mucoromycota → Glomeromycotina → Glomeromycetes → Diversisporales → Diversisporaceae → Diversispora → Diversispora epigaea1365Open in IMG/M
3300009586|Ga0115591_1134240All Organisms → cellular organisms → Eukaryota1515Open in IMG/M
3300009587|Ga0115602_1238161All Organisms → cellular organisms → Eukaryota → Metamonada → Fornicata → Diplomonadida → Hexamitidae → Hexamitinae → Trepomonas → unclassified Trepomonas → Trepomonas sp. PC1969Open in IMG/M
3300009755|Ga0115592_1008848All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Fungi incertae sedis → Mucoromycota → Glomeromycotina → Glomeromycetes → Diversisporales → Diversisporaceae → Diversispora → Diversispora epigaea1359Open in IMG/M
3300009755|Ga0115592_1009435All Organisms → cellular organisms → Eukaryota → Metamonada → Fornicata → Diplomonadida → Hexamitidae → Hexamitinae → Trepomonas → unclassified Trepomonas → Trepomonas sp. PC11215Open in IMG/M
3300009916|Ga0132235_100268All Organisms → cellular organisms → Eukaryota → Metamonada → Fornicata → Diplomonadida → Hexamitidae → Hexamitinae → Trepomonas → unclassified Trepomonas → Trepomonas sp. PC11385Open in IMG/M
3300010861|Ga0126349_1045145All Organisms → cellular organisms → Eukaryota → Metamonada → Fornicata → Diplomonadida → Hexamitidae → Hexamitinae → Trepomonas → unclassified Trepomonas → Trepomonas sp. PC11513Open in IMG/M
3300011340|Ga0151652_11207838All Organisms → cellular organisms → Eukaryota → Metamonada → Fornicata → Diplomonadida → Hexamitidae → Hexamitinae → Trepomonas → unclassified Trepomonas → Trepomonas sp. PC11390Open in IMG/M
3300011340|Ga0151652_13426823All Organisms → cellular organisms → Eukaryota → Metamonada → Fornicata → Diplomonadida → Hexamitidae → Hexamitinae → Trepomonas → unclassified Trepomonas → Trepomonas sp. PC11156Open in IMG/M
3300012524|Ga0129331_1191256All Organisms → cellular organisms → Eukaryota → Metamonada → Fornicata → Diplomonadida → Hexamitidae → Hexamitinae → Trepomonas → unclassified Trepomonas → Trepomonas sp. PC11148Open in IMG/M
3300012719|Ga0157600_1070588All Organisms → cellular organisms → Eukaryota → Metamonada → Fornicata → Diplomonadida → Hexamitidae → Hexamitinae → Trepomonas → unclassified Trepomonas → Trepomonas sp. PC11324Open in IMG/M
3300012767|Ga0138267_1007221All Organisms → cellular organisms → Eukaryota → Metamonada → Fornicata → Diplomonadida → Hexamitidae → Hexamitinae → Trepomonas → unclassified Trepomonas → Trepomonas sp. PC11315Open in IMG/M
3300012969|Ga0129332_1107067All Organisms → cellular organisms → Eukaryota → Metamonada → Fornicata → Diplomonadida → Hexamitidae → Hexamitinae → Trepomonas → unclassified Trepomonas → Trepomonas sp. PC11317Open in IMG/M
3300016687|Ga0180047_1062510All Organisms → cellular organisms → Eukaryota → Metamonada → Fornicata → Diplomonadida → Hexamitidae → Hexamitinae → Trepomonas → unclassified Trepomonas → Trepomonas sp. PC11031Open in IMG/M
3300016698|Ga0181503_1014314All Organisms → cellular organisms → Eukaryota → Metamonada → Fornicata → Diplomonadida → Hexamitidae1047Open in IMG/M
3300016705|Ga0181507_1145768All Organisms → cellular organisms → Eukaryota → Metamonada → Fornicata → Diplomonadida → Hexamitidae → Hexamitinae → Trepomonas → unclassified Trepomonas → Trepomonas sp. PC11366Open in IMG/M
3300019191|Ga0180035_1070718All Organisms → cellular organisms → Eukaryota → Metamonada → Fornicata → Diplomonadida → Hexamitidae → Hexamitinae → Trepomonas → unclassified Trepomonas → Trepomonas sp. PC11272Open in IMG/M
3300019199|Ga0187789_1226725All Organisms → cellular organisms → Eukaryota1387Open in IMG/M
3300019213|Ga0179950_1001133All Organisms → cellular organisms → Eukaryota1313Open in IMG/M
3300019213|Ga0179950_1080999All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Fungi incertae sedis → Mucoromycota → Glomeromycotina → Glomeromycetes → Diversisporales → Diversisporaceae → Diversispora → Diversispora epigaea690Open in IMG/M
3300019215|Ga0179945_1185947All Organisms → cellular organisms → Eukaryota → Metamonada → Fornicata → Diplomonadida → Hexamitidae → Hexamitinae → Trepomonas → unclassified Trepomonas → Trepomonas sp. PC11437Open in IMG/M
3300019216|Ga0179939_1123992All Organisms → cellular organisms → Eukaryota1110Open in IMG/M
3300019221|Ga0179941_1017377All Organisms → cellular organisms → Eukaryota1533Open in IMG/M
3300019221|Ga0179941_1072175All Organisms → cellular organisms → Eukaryota → Metamonada → Fornicata → Diplomonadida → Hexamitidae → Hexamitinae → Trepomonas → unclassified Trepomonas → Trepomonas sp. PC11402Open in IMG/M
3300019231|Ga0179935_1212931All Organisms → cellular organisms → Eukaryota → Metamonada → Fornicata → Diplomonadida → Hexamitidae → Hexamitinae → Trepomonas → unclassified Trepomonas → Trepomonas sp. PC11498Open in IMG/M
3300019231|Ga0179935_1248264All Organisms → cellular organisms → Eukaryota1117Open in IMG/M
3300019238|Ga0180112_1164637All Organisms → cellular organisms → Eukaryota → Metamonada → Fornicata → Diplomonadida → Hexamitidae → Hexamitinae → Trepomonas → unclassified Trepomonas → Trepomonas sp. PC11476Open in IMG/M
3300019240|Ga0181510_1081455All Organisms → cellular organisms → Eukaryota → Metamonada → Fornicata → Diplomonadida → Hexamitidae → Hexamitinae → Trepomonas → unclassified Trepomonas → Trepomonas sp. PC11301Open in IMG/M
3300019242|Ga0181502_1248451All Organisms → cellular organisms → Eukaryota → Metamonada → Fornicata → Diplomonadida → Hexamitidae → Hexamitinae → Trepomonas → unclassified Trepomonas → Trepomonas sp. PC11414Open in IMG/M
3300019242|Ga0181502_1503748All Organisms → cellular organisms → Eukaryota → Metamonada → Fornicata → Diplomonadida → Hexamitidae → Hexamitinae → Trepomonas → unclassified Trepomonas → Trepomonas sp. PC11457Open in IMG/M
3300019246|Ga0172287_1252351All Organisms → cellular organisms → Eukaryota → Metamonada → Fornicata → Diplomonadida → Hexamitidae → Hexamitinae → Trepomonas → unclassified Trepomonas → Trepomonas sp. PC11387Open in IMG/M
3300019249|Ga0184648_1037787All Organisms → cellular organisms → Eukaryota → Metamonada → Fornicata → Diplomonadida → Hexamitidae → Hexamitinae → Trepomonas → unclassified Trepomonas → Trepomonas sp. PC11495Open in IMG/M
3300019251|Ga0187795_1218298All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Fungi incertae sedis → Mucoromycota → Glomeromycotina → Glomeromycetes → Diversisporales → Diversisporaceae → Diversispora → Diversispora epigaea716Open in IMG/M
3300019252|Ga0172286_1192472All Organisms → cellular organisms → Eukaryota → Metamonada → Fornicata → Diplomonadida → Hexamitidae → Hexamitinae → Trepomonas → unclassified Trepomonas → Trepomonas sp. PC11389Open in IMG/M
3300019256|Ga0181508_1629258All Organisms → cellular organisms → Eukaryota → Metamonada → Fornicata → Diplomonadida → Hexamitidae → Hexamitinae → Trepomonas → unclassified Trepomonas → Trepomonas sp. PC11134Open in IMG/M
3300019263|Ga0184647_1207084All Organisms → cellular organisms → Eukaryota → Metamonada → Fornicata → Diplomonadida → Hexamitidae → Hexamitinae → Trepomonas → unclassified Trepomonas → Trepomonas sp. PC11490Open in IMG/M
3300019284|Ga0187797_1768473All Organisms → cellular organisms → Eukaryota702Open in IMG/M
3300020014|Ga0182044_1044124All Organisms → cellular organisms → Eukaryota → Metamonada → Fornicata → Diplomonadida → Hexamitidae → Hexamitinae → Trepomonas → unclassified Trepomonas → Trepomonas sp. PC11347Open in IMG/M
3300020063|Ga0180118_1139322All Organisms → cellular organisms → Eukaryota → Metamonada → Fornicata → Diplomonadida → Hexamitidae → Hexamitinae → Trepomonas → unclassified Trepomonas → Trepomonas sp. PC11156Open in IMG/M
3300020065|Ga0180113_1292437All Organisms → cellular organisms → Eukaryota → Metamonada → Fornicata → Diplomonadida → Hexamitidae → Hexamitinae → Trepomonas → unclassified Trepomonas → Trepomonas sp. PC11491Open in IMG/M
3300021284|Ga0210299_111345All Organisms → cellular organisms → Eukaryota1074Open in IMG/M
3300021325|Ga0210301_1124748All Organisms → cellular organisms → Eukaryota → Metamonada → Fornicata → Diplomonadida → Hexamitidae → Hexamitinae → Trepomonas → unclassified Trepomonas → Trepomonas sp. PC11022Open in IMG/M
3300021849|Ga0210304_1060504All Organisms → cellular organisms → Eukaryota → Metamonada → Fornicata → Diplomonadida → Hexamitidae → Hexamitinae → Trepomonas → unclassified Trepomonas → Trepomonas sp. PC11160Open in IMG/M
3300021858|Ga0213852_1198463All Organisms → cellular organisms → Eukaryota → Metamonada → Fornicata → Diplomonadida → Hexamitidae → Hexamitinae → Trepomonas → unclassified Trepomonas → Trepomonas sp. PC11090Open in IMG/M
3300022154|Ga0213929_1002384All Organisms → cellular organisms → Eukaryota → Metamonada → Fornicata → Diplomonadida → Hexamitidae → Hexamitinae → Trepomonas → unclassified Trepomonas → Trepomonas sp. PC11508Open in IMG/M
3300022161|Ga0213931_1009192All Organisms → cellular organisms → Eukaryota → Metamonada → Fornicata → Diplomonadida → Hexamitidae → Hexamitinae → Trepomonas → unclassified Trepomonas → Trepomonas sp. PC11112Open in IMG/M
3300022161|Ga0213931_1009311All Organisms → cellular organisms → Eukaryota1105Open in IMG/M
3300022166|Ga0213932_1016181All Organisms → cellular organisms → Eukaryota → Metamonada → Fornicata → Diplomonadida → Hexamitidae → Hexamitinae → Trepomonas → unclassified Trepomonas → Trepomonas sp. PC11099Open in IMG/M
3300022373|Ga0210319_1001446All Organisms → cellular organisms → Eukaryota → Metamonada → Fornicata → Diplomonadida → Hexamitidae1616Open in IMG/M
3300023546|Ga0228705_100271All Organisms → cellular organisms → Eukaryota → Metamonada → Fornicata → Diplomonadida → Hexamitidae → Hexamitinae → Trepomonas → unclassified Trepomonas → Trepomonas sp. PC11510Open in IMG/M
3300023697|Ga0228706_1005451All Organisms → cellular organisms → Eukaryota → Opisthokonta → Fungi → Fungi incertae sedis → Mucoromycota → Glomeromycotina → Glomeromycetes → Diversisporales → Diversisporaceae → Diversispora → Diversispora epigaea1506Open in IMG/M
3300023697|Ga0228706_1010103All Organisms → cellular organisms → Eukaryota → Metamonada → Fornicata → Diplomonadida → Hexamitidae → Hexamitinae → Trepomonas → unclassified Trepomonas → Trepomonas sp. PC11135Open in IMG/M
3300023703|Ga0228708_1009187All Organisms → cellular organisms → Eukaryota → Metamonada → Fornicata → Diplomonadida → Hexamitidae → Hexamitinae → Trepomonas → unclassified Trepomonas → Trepomonas sp. PC11466Open in IMG/M
3300024481|Ga0256330_1025635All Organisms → cellular organisms → Eukaryota → Metamonada → Fornicata → Diplomonadida → Hexamitidae1254Open in IMG/M
3300024531|Ga0255228_1050042All Organisms → cellular organisms → Eukaryota → Metamonada → Fornicata → Diplomonadida → Hexamitidae → Hexamitinae → Trepomonas → unclassified Trepomonas → Trepomonas sp. PC1838Open in IMG/M
3300024543|Ga0256348_1022058All Organisms → cellular organisms → Eukaryota → Metamonada → Fornicata → Diplomonadida → Hexamitidae → Hexamitinae → Trepomonas → unclassified Trepomonas → Trepomonas sp. PC11070Open in IMG/M
3300024573|Ga0256337_1045296All Organisms → cellular organisms → Eukaryota → Metamonada → Fornicata → Diplomonadida → Hexamitidae1119Open in IMG/M
3300024867|Ga0255267_1021083All Organisms → cellular organisms → Eukaryota → Metamonada → Fornicata → Diplomonadida → Hexamitidae → Hexamitinae → Trepomonas → unclassified Trepomonas → Trepomonas sp. PC11484Open in IMG/M
3300025867|Ga0209098_1043179All Organisms → cellular organisms → Eukaryota2351Open in IMG/M
3300026571|Ga0255289_1023378All Organisms → cellular organisms → Eukaryota1385Open in IMG/M
3300028105|Ga0255254_1057611All Organisms → cellular organisms → Eukaryota785Open in IMG/M
3300028283|Ga0268283_1024534All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae2000Open in IMG/M
3300028623|Ga0257141_1001175All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea → Stichotrichia → Sporadotrichida → Oxytrichidae5474Open in IMG/M
3300028623|Ga0257141_1012428All Organisms → cellular organisms → Eukaryota → Metamonada → Fornicata → Diplomonadida → Hexamitidae → Hexamitinae → Trepomonas → unclassified Trepomonas → Trepomonas sp. PC11718Open in IMG/M
3300028739|Ga0302205_10008684All Organisms → cellular organisms → Eukaryota3012Open in IMG/M
3300028743|Ga0302262_10005611All Organisms → cellular organisms → Eukaryota4723Open in IMG/M
3300028762|Ga0302202_10014997All Organisms → cellular organisms → Eukaryota6430Open in IMG/M
3300028766|Ga0302269_1003387All Organisms → cellular organisms → Eukaryota → Metamonada → Fornicata → Diplomonadida → Hexamitidae → Hexamitinae → Trepomonas → unclassified Trepomonas → Trepomonas sp. PC16689Open in IMG/M
3300028766|Ga0302269_1013174All Organisms → cellular organisms → Eukaryota → Metamonada → Fornicata → Diplomonadida → Hexamitidae → Hexamitinae → Trepomonas → unclassified Trepomonas → Trepomonas sp. PC12919Open in IMG/M
(restricted) 3300029286|Ga0247841_10050116All Organisms → cellular organisms → Eukaryota → Metamonada → Fornicata → Diplomonadida → Hexamitidae → Hexamitinae → Trepomonas → unclassified Trepomonas → Trepomonas sp. PC13936Open in IMG/M
3300029923|Ga0311347_10028762Not Available3572Open in IMG/M
3300029989|Ga0311365_10027117All Organisms → cellular organisms → Eukaryota4921Open in IMG/M
3300029989|Ga0311365_11286342All Organisms → cellular organisms → Eukaryota → Metamonada → Fornicata → Diplomonadida → Hexamitidae → Hexamitinae → Trepomonas → unclassified Trepomonas → Trepomonas sp. PC1629Open in IMG/M
3300030000|Ga0311337_10010629All Organisms → cellular organisms → Eukaryota7207Open in IMG/M
3300030294|Ga0311349_10030162All Organisms → cellular organisms → Eukaryota4909Open in IMG/M
3300030294|Ga0311349_10490551All Organisms → cellular organisms → Eukaryota → Metamonada → Fornicata → Diplomonadida → Hexamitidae → Hexamitinae → Trepomonas → unclassified Trepomonas → Trepomonas sp. PC11162Open in IMG/M
3300030339|Ga0311360_10522961All Organisms → cellular organisms → Eukaryota → Metamonada → Fornicata → Diplomonadida → Hexamitidae → Hexamitinae → Trepomonas → unclassified Trepomonas → Trepomonas sp. PC1950Open in IMG/M
3300030491|Ga0302211_10005040All Organisms → cellular organisms → Eukaryota3726Open in IMG/M
3300031759|Ga0316219_1007141All Organisms → cellular organisms → Eukaryota7211Open in IMG/M
3300033527|Ga0316586_1010652All Organisms → cellular organisms → Eukaryota → Metamonada → Fornicata → Diplomonadida → Hexamitidae → Hexamitinae → Trepomonas → unclassified Trepomonas → Trepomonas sp. PC11397Open in IMG/M
3300033541|Ga0316596_1033746All Organisms → cellular organisms → Eukaryota → Metamonada → Fornicata → Diplomonadida → Hexamitidae → Hexamitinae → Trepomonas → unclassified Trepomonas → Trepomonas sp. PC11334Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
WetlandEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Wetland11.50%
Anaerobic Digestor SludgeEngineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge9.73%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen7.96%
FreshwaterEnvironmental → Aquatic → Freshwater → Creek → Unclassified → Freshwater7.08%
FreshwaterEnvironmental → Aquatic → Freshwater → River → Unclassified → Freshwater6.19%
PeatlandEnvironmental → Aquatic → Freshwater → Wetlands → Bog → Peatland5.31%
Peatlands SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Peatlands Soil5.31%
Groundwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Groundwater Sediment4.42%
EstuarineEnvironmental → Aquatic → Marine → Intertidal Zone → Estuary → Estuarine4.42%
AqueousEnvironmental → Aquatic → Marine → Coastal → Unclassified → Aqueous3.54%
BogEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Bog3.54%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater2.65%
MarineEnvironmental → Aquatic → Marine → Oceanic → Unclassified → Marine2.65%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine2.65%
PeatlandEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Peatland2.65%
Wastewater EffluentEngineered → Wastewater → Nutrient Removal → Unclassified → Unclassified → Wastewater Effluent2.65%
WetlandEnvironmental → Aquatic → Freshwater → Wetlands → Sediment → Wetland1.77%
RhizosphereHost-Associated → Plants → Rhizosphere → Unclassified → Unclassified → Rhizosphere1.77%
Activated SludgeEngineered → Wastewater → Activated Sludge → Unclassified → Unclassified → Activated Sludge1.77%
WatershedsEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Watersheds0.89%
Freshwater LakeEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater Lake0.89%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Hypolimnion → Freshwater0.89%
Freshwater Lake HypolimnionEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater Lake Hypolimnion0.89%
GroundwaterEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater0.89%
Sinkhole FreshwaterEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Sinkhole Freshwater0.89%
Meromictic PondEnvironmental → Aquatic → Freshwater → Pond → Unclassified → Meromictic Pond0.89%
Salt MarshEnvironmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh0.89%
Saline WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water0.89%
Beach Aquifer PorewaterEnvironmental → Aquatic → Unclassified → Unclassified → Unclassified → Beach Aquifer Porewater0.89%
Deep SubsurfaceEnvironmental → Terrestrial → Deep Subsurface → Unclassified → Unclassified → Deep Subsurface0.89%
Polar MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Polar Marine0.89%
Boreal Forest SoilEnvironmental → Terrestrial → Soil → Unclassified → Unclassified → Boreal Forest Soil0.89%
Wastewater SludgeEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Wastewater Sludge0.89%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
3300001242Groundwater microbial communities from Rifle, Colorado - Groundwater E2EnvironmentalOpen in IMG/M
3300002024Sinkhole freshwater microbial communities from Lake Huron, USA - Flux 1k-1.5kEnvironmentalOpen in IMG/M
3300004474Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 60 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004506Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 70 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004561Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 6 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004595Marine microbial communities from expanding oxygen minimum zones in the Saanich Inlet - ESP_125SG_5_RNA (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004607Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 36 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004609Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 50 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300004614Peat soil microbial communities from Weissenstadt, Germany - Metatranscriptome 48 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006228Marine sediment microbial communities, 0.7 km from oil contamination, elevated hydrocarbon, Gulf of Mexico ? BC139EnvironmentalOpen in IMG/M
3300006231Marine sediment microbial communities, 2.7 km from oil contamination, elevated hydrocarbon, Gulf of Mexico ? BC278EnvironmentalOpen in IMG/M
3300006232Marine sediment microbial communities, 0.5 km from oil contamination,elevated hydrocarbon, Gulf of Mexico - BC315EnvironmentalOpen in IMG/M
3300006375Aqueous microbial communities from the Delaware River and Bay under freshwater to marine salinity gradient to study organic matter cycling in a time-series - DEBay_Spr_0.19_>0.8_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300006388Active sludge microbial communities from Illinois, USA, of municipal wastewater-treating anaerobic digesters - ADurb_Gel_01_SludgeMetaT (Metagenome Metatranscriptome)EngineeredOpen in IMG/M
3300006594Active sludge microbial communities from Illinois, USA, of municipal wastewater-treating anaerobic digesters - ADurb_Ile_03_SludgeMetaT (Metagenome Metatranscriptome)EngineeredOpen in IMG/M
3300006645Active sludge microbial communities from Klosterneuburg, Austria - Klosterneuburg WWTP active sludge MT KNB_T0_3 (Metagenome Metatranscriptome)EngineeredOpen in IMG/M
3300007221Active sludge microbial communities from Klosterneuburg, Austria - Klosterneuburg WWTP active sludge MT KNB_C1_LD (Metagenome Metatranscriptome)EngineeredOpen in IMG/M
3300007244Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 6/11/14 C2 RNA (Eukaryote Community Metatranscriptome)EngineeredOpen in IMG/M
3300007248Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 6/11/14 D RNA (Eukaryote Community Metatranscriptome)EngineeredOpen in IMG/M
3300007253Wastewater effluent complex algal communities from Wisconsin, to seasonally profile nutrient transformation and Carbon sequestration - JI 10/23/14 A1 RNA (Eukaryote Community Metatranscriptome)EngineeredOpen in IMG/M
3300008569Microbial communities of Cyanobacterial mats from a recreation lake in Champs-sur-Marne, France - CSM2012-MB-F-NEnvironmentalOpen in IMG/M
3300009175Freshwater lake bacterial and archeal communities from Alinen Mustajarvi, Finland, to study Microbial Dark Matter (Phase II) - Alinen Mustajarvi 5m metaGEnvironmentalOpen in IMG/M
3300009196Microbial communities of wastewater sludge from Singapore - Sludge1_b2_FebruaryEnvironmentalOpen in IMG/M
3300009419Subsurface microbial communities from deep shales in Ohio, USA - Utica-3 well 1 S input2 FTEnvironmentalOpen in IMG/M
3300009538Microbial community of beach aquifer porewater from Cape Shores, Lewes, Delaware, USA - H-2WEnvironmentalOpen in IMG/M
3300009579Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_9_15_C (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009580Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_11_14_C (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009581Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_9_15_A (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009583Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_9_15_B (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009586Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_11_14_A (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009587Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Mud_9_15_C (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009755Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_11_14_B (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300009916Aquatic microbial communities from different depth of meromictic Siders Pond, Falmouth, Massachusetts; Cast 6, 12m depth; RNA IDBA-UDEnvironmentalOpen in IMG/M
3300010861Boreal forest soil eukaryotic communities from Alaska, USA - C4-5 Metatranscriptome (Eukaryote Community Metatranscriptome)EnvironmentalOpen in IMG/M
3300011340Combined Assembly of Wetland MetatranscriptomesEnvironmentalOpen in IMG/M
3300012524Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_RNA1 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012719Eutrophic lake water microbial communities from Lake Mendota, Wisconsin, USA - GEODES123 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012767Metatranscriptomics of polar marine prokaryotic and eukaryotic communities from Arthur Harbor ice station, Antarctica - RNA29.ICE_1m.20151125 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300012969Freshwater to marine salinity gradient microbial communities from Chesapeake Bay, USA - CPBay_Spr_31_0.2_RNA2 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016687Dystrophic lake water microbial communities from Trout Bog Lake, Wisconsin, USA - GEODES104 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016698Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_30_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300016705Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin06_30_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019191Estuarine microbial communities from the Columbia River estuary - R.880 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019199Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_QUI02_MP05_10_MT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019213Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan ? AD_JPNHW2_MetaT (Metagenome Metatranscriptome)EngineeredOpen in IMG/M
3300019215Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Illinois, USA ? AD_STIC12_MetaT (Metagenome Metatranscriptome)EngineeredOpen in IMG/M
3300019216Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Illinois, USA ? AD_UKC032_MetaT (Metagenome Metatranscriptome)EngineeredOpen in IMG/M
3300019221Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Illinois, USA ? AD_UKC048_MetaT (Metagenome Metatranscriptome)EngineeredOpen in IMG/M
3300019231Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Illinois, USA ? AD_UKC057_MetaT (Metagenome Metatranscriptome)EngineeredOpen in IMG/M
3300019238Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT466_16_1Ra (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019240Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin11_10_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019242Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin02_10_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019246Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_deep_8_15_core_2 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019249Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_32 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019251Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0116_SJ02_MP15_10_MT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019252Wetland microbial communities from Old Woman Creek Reserve in Ohio, USA - Plant_deep_8_15_core_1 metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019256Metatranscriptome of peatland microbial communities from Houghton, MN, USA - PEATcosm2014_Bin10_10_metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019263Metatranscriptome of groundwater sediment microbial communities from an aquifer in East River, Colorado, USA - PLM4_5 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300019284Metatranscriptome of tropical peat soil microbial communities from peatlands in Department of Meta, Colombia - 0216_BV02_MP05_10_MT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020014Metatranscriptome of coastal salt marsh microbial communities from the Groves Creek Marsh, Georgia, USA - 011503CT metaT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020063Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT730_16_1Ra (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300020065Metatranscriptome of soil microbial communities from meander-bound floodplain in the East River, Colorado, USA - East River metaT ERMLT499_16_1Ra (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021284Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R878 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021325Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1033 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021849Metatranscriptome of estuarine water microbial communities from the Columbia River estuary, Oregon, United States ? R1037 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300021858Metatranscriptome of freshwater sediment microbial communities from post-fracked creek in Pennsylvania, United States - ABR_2015 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022154Metatranscriptome of freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 1-17 MT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022161Metatranscriptome of freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 3-17 MT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022166Metatranscriptome of freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 11-17 MT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300022373Metatranscriptome of estuarine sediment microbial communities from the Columbia River estuary, Washington, United States ? S.180 (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023546Metatranscriptome of freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 2-17_Aug_MT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023697Metatranscriptome of freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 3-17_Aug_MT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300023703Metatranscriptome of freshwater microbial communities from McNutts Creek, Athens, Georgia, United States - 20-17_Aug_MT (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024481Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Cont_RepC_0h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024531Metatranscriptome of freshwater microbial communities from Columbia River, Oregon, United States - Colum_Law_RepA_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024543Metatranscriptome of freshwater microbial communities from Mississippi River, Louisiana, United States - Miss_Cont_RepA_0h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024573Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Atl_RepA_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300024867Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_Yuk_RepA_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300025867Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNHW1_MetaG (SPAdes)EngineeredOpen in IMG/M
3300026571Metatranscriptome of freshwater microbial communities from Altamaha River, Georgia, United States - Atl_UVDOM_RepB_8d (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028105Metatranscriptome of freshwater microbial communities from St. Lawrence River, New York, United States - Law_Atlam_RepA_8h (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028283Saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2013_06_06_36mEnvironmentalOpen in IMG/M
3300028623Metatranscriptome of saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2011_1_27_36m (Metagenome Metatranscriptome)EnvironmentalOpen in IMG/M
3300028739Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_E1_3EnvironmentalOpen in IMG/M
3300028743Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_E3_4EnvironmentalOpen in IMG/M
3300028762Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Bog_N3_3EnvironmentalOpen in IMG/M
3300028766Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - III_Bog_E2_2EnvironmentalOpen in IMG/M
3300029286 (restricted)Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_18mEnvironmentalOpen in IMG/M
3300029923II_Fen_E1 coassemblyEnvironmentalOpen in IMG/M
3300029989III_Fen_N1 coassemblyEnvironmentalOpen in IMG/M
3300030000I_Fen_N3 coassemblyEnvironmentalOpen in IMG/M
3300030294II_Fen_E3 coassemblyEnvironmentalOpen in IMG/M
3300030339III_Bog_N1 coassemblyEnvironmentalOpen in IMG/M
3300030491Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_E3_3EnvironmentalOpen in IMG/M
3300031759Freshwater microbial communities from Trout Bog Lake, Wisconsin, USA - TBH18003PEnvironmentalOpen in IMG/M
3300033527Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M
3300033541Metatranscriptome of rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA (Metagenome Metatranscriptome)Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
C687J13896_100465943300001242GroundwaterMHHYRPNRKRTLNLSLHKASGPGKFCVLSQIEPQTPRLVVPFRQCFQVSVLQPYFPQSLKPSGFLGTASTAPAV*
MIS_117890213300002024Sinkhole FreshwaterKRTLNLLLRKASGSGKICVLSQIEPQTPRLVVSFRQYLQVSILQSYFPQNPKPYGFPGDADLLARF*
Ga0068968_100794423300004474Peatlands SoilMHHHQPNRKRTLNLLLRKASGPGKFCVLGQIEPQTPRLVVFLRQFLQVSILQPYFPQSLKPFGFLGIVIIATTILMVSFKA*
Ga0068973_101232423300004506Peatlands SoilMHHQLPNRKRTLNLLLRKASGSGKICVLGQIEPQTPRLVVSFRQYLQVSVLQPYSPQNPKPSGFPRNASEPAFEMVSFKA*
Ga0068921_102853913300004561Peatlands SoilMHHQLPNRKRTLNLLLRKASGSVKFCVLSQIEPQTPRLVVSFRQYLQVSVLQPYSPQNSKPSGFPGDATTAASEIVSFKA*
Ga0008278_122628823300004595MarineMHHQLPNHKRTLNLLFRKASGSGKICVLSQIEPQTPRLVVSFRQYLQVSILQSYSPQNPKPYGFPGDAIVVDRF*
Ga0068948_103557523300004607Peatlands SoilKADSLHHELGAAMHHQLPNRKRTLNLLLRKASGSGKICVLSQIEPQTPRLVVSFRQYLQVSILQSYFPQNPKPYGFPGDADLLARF*DGIV*
Ga0068958_102652713300004609Peatlands SoilMHHQLPNRKRTLNLLLRKASGSGKICVLSQIETQTPRLVVSFRQYLQVSVLQPYSPQNPKPSGFPGDATRAASEMVSFKARNKTVSNHRLSSHFRS*
Ga0068956_104784513300004614Peatlands SoilMHHQLPNRKRTLNLLLRKASGSVKFCVLGQIEPQTPRLVVSFRQYLQVSVLQPYSPQNSKPSGFPGDATTAASEIVSFKA*
Ga0082388_12376533300006228MarineMHHQLPNRKRTLNLLLRKASGSGKICVLSQIEPQTPRLVVSFRQYLQVSVLQPYSPQNPKPSGFPRNAS*
Ga0082391_13154633300006231MarineMHHQLPNRKRTINLLLRKASGSGKIYVLSQIEPQTPRLVVSFRQYLQVSVLQPYSPQDPKPSGFPRYASEPAYEMVSFKA*
Ga0082392_12017213300006232MarineMHHQLPNRKRTINLLLRKASGSGKIYVLGQIEPQTPRLVVSFRQYLQVSVLQPYSPQDPKPSGFPRYASEPAYEMVSFKA*
Ga0075490_102677213300006375AqueousLNLLLRKASGSGKICVLSQIEPQTPRLVVSFRQYLQVSVLQPYSPQNPKPSGFPRNASEPAFEMVSFKA*
Ga0075490_108209413300006375AqueousMHHQLPNRKRTLNLLLRKASGSGKICVLGQIEPQTPRLVVSFRQYFQVSILQSYSPQNPKPYGFPGDANVYVRF*
Ga0079062_107201023300006388Anaerobic Digestor SludgeMHHQLPNRKRTLNLLLRKASGSGKICVLSQIEPQTPRLVVSFRQYLQVSVLQPYSPQNPKPSGFPRNASEPAFEMVSFKA*
Ga0079073_125635013300006594Anaerobic Digestor SludgeMHHQLPNRKRTLNLLLRKASGSGKICVLSQIEPQTPRLVVVFRQYLQVSILQSYFPQNPKPCGFP*
Ga0099769_101545223300006645Activated SludgeMHHQLPNRKRTLNLLLRKASGSGKICVLGQIEPQTPRLVVSFRQYLQVSVLQPYSPQNPKPSGFPGDANCSASEMVSFKA*
Ga0099765_132414813300007221Activated SludgeMHHQLPNRKRTLNLLLRKASGSGKICVLGQIEPQTPRLVVSFRQYLQVSVLQPYSPQNPKPSGFPGDASRPTSEMVSFKA*
Ga0075167_1105535913300007244Wastewater EffluentMHHQLPDRKRTLNLLLRKASGSGKVCVLSQIEPQTPRLVVSFRQCLQVSVLQPYSPQNPKPSGFPGDASAPASEMVSFKA*
Ga0075168_112291213300007248Wastewater EffluentMHHQLPDRKRTLNLLLRKASGSGKVCVLGQIEPQTPRLVVSFRQCLQVSVLQPYSPQNPKPSGFPGDASAPASEMVSFKA*
Ga0075182_1129290613300007253Wastewater EffluentMHHQLPNRKRTLNLLLRKASGSGKICVLGQIEPQTPRLVVSFRQCLQVSVLQPYSPQNPKPSGFPGDASAPASEMVSFKA*
Ga0103779_10064913300008569Freshwater LakeMHHQLPNRKRTLNLLLRKASGSGKICVLGQIEPQTPRLVVSFRQYLQVSILQSYSPQNPKPYGFPGDADVNARF*
Ga0073936_1037108913300009175Freshwater Lake HypolimnionMHHQLPNRKRTLNLLLRKASGSGKICVLSQIEPQTPRLVVSFRQYLQVSILQSYFPQNPKPCGFP*
Ga0103745_1000759313300009196Wastewater SludgeMHHQLPNRKRTLNLLLRKASGSGKICVLGQIEPQTPRLVVSFRQYLQVSVLQPYPPQNPKPSGFPRNASEPAFEMVSFKA*
Ga0114982_113878213300009419Deep SubsurfaceMHHQLPNRKRTLNLLLRKASGSGKICVLSQIEPQTPRLVVSFRQYLQVSILQSYSPQNPKPYGFPGDADVNARF*
Ga0129287_1012928613300009538Beach Aquifer PorewaterMHHQLPNRKRTLNLLLRKASGSGKICVLSQIEPQTPRLVVSFRQYFQVSILQSYSPQNPKPYGFPGDANVYVRF*
Ga0115599_107964313300009579WetlandMHHQLPNRKRTLNLLLRKASGSGKVSVLGQIEPQTPRLVVSLRQFLQVSILQSYSPQNLSPRGFP*
Ga0115599_107975713300009579WetlandMHHQPPNRKRTLNLLLRKASEPGKIGVLGQIEPQTPRLVVSFRQCLQVSVLRPYFPQNQKPFGFPGAASIRLLR*
Ga0115596_104153933300009580WetlandMHHQLPNRKRTLNLLLRKASGSGKICVLCQIKPQTPRLVVSFRQYLQVSVLQPYFPQNQKPYGFLGAASTCARCLDGIV*
Ga0115600_114372413300009581WetlandMHHQLPNRKRTLNLLLRKASGSGKVSVLGQIEPQTPRLVVSLRQSLQVSILQSYSPQNLKPRGFP*
Ga0115598_101181213300009583WetlandMHHQLPNRKRTLNLLLRRASGSGKIRVLGQIEPQTPRLVVSFRQCLQVSVLQPYFPQNLKPYGFPGAANFVSAAWMVSFKAQNKTVSNHRLSLRCRS*
Ga0115598_108455913300009583WetlandPNRKRTLNLLLRKASGSGKVSVLGQIEPQTPRLVVSLRQFLQVSILQSYSPQNLRPRGFP
Ga0115598_116742413300009583WetlandMHHHLLNHEKTINLSISKASGSGKICVLCQIKPQTPRLVVSLRQYFQVSVLQPYFPQSLKPFDFSGNMTGKTGHIGGGIV*
Ga0115591_113424013300009586WetlandMHHQLPNRKRTLNLLLRKASGSGKICVLGQIKPQTPRLVVSFRQYLQVSVLQPYFPQNQKPYGFLGAASTCARCLDGIV*
Ga0115602_123816133300009587WetlandMHHQLPNRKRSLSLLLRKASGSGKICVLGQIEPQTPRLVVSLRQCLQVSDLHPYFPQSLKPYGFLGAASNAPAA*
Ga0115592_100884813300009755WetlandMHHHLLNHEKTLNLSIGKASRSSEMCVLGQIKPQTPRLVVSLRQYFQVSVLQPYYPQSLKPFDFSGNATRRASRYGGGIV*
Ga0115592_100943513300009755WetlandMHHYRPNRKRTLNLSLHKASGPGKFCVLGQIEPQTPRLVVPFRQCFQVSVLQPYFPQSLKPSGFLGTASTTPAV*
Ga0132235_10026823300009916Meromictic PondMHHQLPNRKRSLSLLLRKASGSGKICVLSQIEPQTPRLVVSLRQYLQVSDLHPYFPQSLKPFGFLGAVSTCAHCLDGSV*
Ga0126349_104514513300010861Boreal Forest SoilMHHQLPNRKRTLNLLLRKASGSGKICVLGQIEPQTPRLVVSFRQYLQVSILQSYYPQNPKPSGFP*
Ga0151652_1120783813300011340WetlandMHHQLPNHKRTLNLLFRRASGSGKVCVLSQIEPQTPRLVVSLRQYLQVSILQSYSPQNLKPFSFLRAASLLAR*
Ga0151652_1342682323300011340WetlandMHHQLPNRKRTLNLSLRRASGSGKISVLSQIEPQTPRLVVSLRQFLQVSILQSYFPQSLITFGFP*
Ga0129331_119125613300012524AqueousMHHQLPDHKRTLNLLFRKASGSGKICVLCQIEPQTPRLVVSFRQYLQVSILQSYSPQNPKPYGFPGDAIVIDRF*
Ga0157600_107058813300012719FreshwaterMHHQLPDRKRTLNLLLRKASGSGKVCVLGQIEPQTPRLVVSFRQYLQVSILNHTPPRTRSLTVSLEMRTSSPASEMVSFKA*
Ga0138267_100722113300012767Polar MarineMHHQLPDHKRTLNLLFRKASGSGKICVLGQIEPQTPRLVVSFRQYLQVSILQSYSPQNPKPYGFPGDAIVIDRF*
Ga0129332_110706713300012969AqueousMHHQLPNHKRTLNLLFRKASGSGKICVLGQIEPQTPRLVVSFRQYLQVSILQSYSPQNPKPYGFPGDAIVIDRF*
Ga0180047_106251013300016687FreshwaterKRTLNLLLRRASGSGKIRVLGQIEPQTPRLVVSFRQCLQVSVLQPYFPQNLKPFGFPGAASFVPAAWMVSFTAQNKTVSNHRLSLRCRS
Ga0181503_101431413300016698PeatlandMHHQLPNHKRTLNLLFRKTSGSGKVCVLGQIEPQTPRLVVSLRQYLQVSILQSYSPQNLKPFGFPEAASHVARYRDDII
Ga0181507_114576823300016705PeatlandMHHHLPNRKRTLNLLLRIASGSGKFCVLGQIEPQTPRLVVFLRQFLQVSILQPYFPQSLKPFGFLGIVTIKATILMVSFKAQNKTVSDHRLSLHFRP
Ga0180035_107071813300019191EstuarineMHHQLPNHKRTLNLLFRKASGAGKICVLSQIAPQTPRLVVSFRQYLQVSILQSYFPQNPKPYGFPGDVDLLAHF
Ga0187789_122672513300019199PeatlandMHHHLPNRKRTLNLLLRIASGSGKFCVLGQIEPQTPRLVVSFRQYLQVSILQSYYPQNPKPSGFP
Ga0179950_100113313300019213Anaerobic Digestor SludgeMHHQLPNHKRTLNLLFRKASGSGKICVLGQIEPQTPRLVVSFRQYLQVSILQSYFPQSPKSSGFP
Ga0179950_108099913300019213Anaerobic Digestor SludgeMHHHLLNHEKAINLSISKASGSDKICVLGQIKPQTPRLVVSLRQYFQVSVLQPYFPQSLKPFDFSDNMTSRTG
Ga0179945_118594713300019215Anaerobic Digestor SludgeMHHQLPNRKRTLNLLLRKASGSGKICVLSQIEPQTPRLVVVFRQYLQVSILQSYFPQNPKPCGFP
Ga0179939_112399223300019216Anaerobic Digestor SludgeMHHQPPNRKRTLNLLLRKASEPGKIGVLGQIEPQTPRLVVSFRQCLQVSVLQPYFPQNQKPYGFPGAAS
Ga0179941_101737723300019221Anaerobic Digestor SludgeMHHQLPDHKRTLNLLFRKASGSGKISVLGQIEPQTPRLVVSFRQYLQVSILRPYSPQNPKPHGFPWVASCARYWDGIV
Ga0179941_107217523300019221Anaerobic Digestor SludgeMHHQLPDRKRTLNLLLRKASGSGKVCVLGQIEPQTPRLVVSFRQCLQVSVLQPYSPQNPKPSGFPGDASAPASEMVSFKA
Ga0179935_121293123300019231Anaerobic Digestor SludgeMHHQLPNRKRTLNLLLRKASGSGKICVLGQIEPQTPRLVVSFRQYLQVSILQSYSPQNPKPFGFPGDASVNACF
Ga0179935_124826423300019231Anaerobic Digestor SludgeMHHQLPNRKRTLNLLLRKASGSGKICVLGQIEPQTPRLVVSFRQYLQVSILQSYFPQNPKPYGFPGDADLLARF
Ga0180112_116463713300019238Groundwater SedimentMHHQLPNRKRTLNLLLRKASGSGKICVLGQIEPQTPRLVVSFRQYLQVSILQSYYPQNPKPSGFP
Ga0181510_108145513300019240PeatlandMHHQLPNRKRTLNLLLRKASGPGKFCVLGQIEPQTPHLVVFLRQFLQVSILQPYFPQSLKPSGFLGTVNVVSTV
Ga0181502_124845113300019242PeatlandMHHQLPNRKRTLNLLLRKASGSGKVSVLSQIEPQIPRLVVSLRQFLQVSILQSYFPQNPRPRGFPQDANVFVCFWDGIV
Ga0181502_150374823300019242PeatlandMHHQLPNRKRTLNLLLRKASGPGKFCVLGQIEPQTPRLVVFLRQFLQVSILQPYFPQSLKPFGFLGIVTIKATILMVSFKAQNKTVSDHRLSLHFRP
Ga0172287_125235113300019246WetlandMHHQLPNRKRTLNLLLRKASGSGKICVLGQIEPQTPRLVVSFRQYLQVSILQSYSPQNPKPYGFPGDADVIARF
Ga0184648_103778723300019249Groundwater SedimentMHHQLPNRKRSLSLLLRKASGSGKICVLGQIEPQTPRLVVSLRQCLQVSDLHPYFPQSLKPFGFLGAVSTCAHCLDGSV
Ga0187795_121829823300019251PeatlandADSLHHELGAAMHHQLPNRKRTLNLLLRKASGSGKISVLGQIEPQTPRLVVSLRQSLQVSILQSYSPQSL
Ga0172286_119247223300019252WetlandMHHQLPNRKRTLNLLLRKASGSGKICVLGQIEPQTPRLVVSFRQYLQVSILQSYFPQNPKPCGFP
Ga0181508_162925813300019256PeatlandKADSLHHELGAAMHHQLPNRKRTLNLLLRKASGSGKVSVLSQIEPQIPRLVVSLRQFLQVSILQSYFPQNPRPRGFPQDANVFVCFWDGIV
Ga0184647_120708423300019263Groundwater SedimentMHHHRPNRKRTLNLSLHKASGPGKFCVLGQIEPQTPRLVVSFRQCFQVSVLQPYFPQSLKPSGFLGTASTAPAV
Ga0187797_176847313300019284PeatlandNKADSLHHELGAAMHHQLPNRKRTLNLLLRKTSGSGKVSVLGQIEPQIPRLVVSLRQFLQVSILQSYFPQNP
Ga0182044_104412423300020014Salt MarshMHHQLPNHKRTLNLLFRKASGSGKICVLGQIEPQTPRLVVSFRQYLQVSILQSYSPQNPKPYGFPGDAIVVDRF
Ga0180118_113932223300020063Groundwater SedimentLLLHKASGSDKIGVLSQIKPQIPRLVVSFRQCLQVSVLQPYFPQSLKPFGFLGMEGTAPSIEMVSFKA
Ga0180113_129243723300020065Groundwater SedimentMHHQLPNRKRSLSLLLRKASGSGKICVLGQIEPQTPRLVVSLRQCLQVSDLHPYFPQSLKPFGFLGAASTCARCLDGSV
Ga0210299_11134513300021284EstuarineMHHQLPNRKRSLSLLLRKASGSGKICVLGQIEPQTPRLVVSFRQYLQVSILQSYFPQNPKPYGFPGDAIVVDRF
Ga0210301_112474813300021325EstuarinePNRKRTLNLLLRKASGSGKICVLGQIEPQTPRLVVSFRQCLQVSVLQPYFPQNLKPFGFPGAASYSPAAWMVSFKA
Ga0210304_106050413300021849EstuarineMHHQLPNRKRTLNLLLRKASGSGKICVLGQIEPQTPRLVVSFRQYLQVSVLQPYSPQNPKPSGFPGDATYAASEMVSFKA
Ga0213852_119846323300021858WatershedsMHHHRPNRKRTLNLSLRKASGPGKFCVLGQIEPQTPRLVVSFRQCFQVSVLQPYFPQSLKPSGFLGTASTTPAV
Ga0213929_100238413300022154FreshwaterMHHQLPNRKRSLSLLLRKASGSGKVCVLGQIEPQTPRLVVSFRQCLQVSDLHPYFPQSLKPFGFPGIASTFARYLDGIV
Ga0213931_100919223300022161FreshwaterMHHHQPNRKRTLNLLLHKASGPGKFCVLGQIKPQTPRLVVSFRQCFQVSALQPYFPQSLKPSGFLGAVSTAPTA
Ga0213931_100931113300022161FreshwaterMHHHLPNRKRTLNLLLHKVSGSGKICVLGQIEPQTPRLVVSLRQYLQVSVLQPYSPQNPKPFGFP
Ga0213932_101618123300022166FreshwaterMHHHQPNRKRTLNLSLHKASGPGKFCVLGQIEPQTPRLVVSFRQCFQVSALQPYFPQSLKPSGFLGAVSTAPTA
Ga0210319_100144623300022373EstuarineMHHQLPNRKRSLSLLLRKASGSGKICVLGQIEPQTPRLVVSLRQYLQVSDLHPYFPQSLKPFGFLGAVSTCAHCLDGSV
Ga0228705_10027113300023546FreshwaterMHHQLPNRKRTLNLLLRKASGSGKICVLGQIKPQTPRLVVSFRQYLQVSILQSYSPQNPKPCGFPRDASLGARF
Ga0228706_100545113300023697FreshwaterMHHQLPDRKRTLNLLLRKASGSGKICVLGQIKPQTPRLVVSFRQYLQVSILQSYSPQNPKPCGFP
Ga0228706_101010323300023697FreshwaterMHHHQPNRKRTLNLLLHKASGPGKFCVLGQIEPQTPRLVVSFRQCFQVSALQPYFPQSLKPSGFLGAVSTAPTA
Ga0228708_100918713300023703FreshwaterMHHHLPNRKRTLNLLLRLTSRPGKICVLGQIEPQTPRLVASFRQFVQVSFLQTYFPQNPKTSDFS
Ga0256330_102563513300024481FreshwaterMHHQLPNRKRTLNLLLRKASGSGKVSVLGQIEPQTPRLVVSLRQFLQVSILQSYSPQNLSPRGFP
Ga0255228_105004213300024531FreshwaterMHHQLPNRKRTLNLLLRKASGSGKICVLGQIEPQTPRLVVSFRQYLQVSILQSYSPQNPKPYGFPGDADVNARF
Ga0256348_102205813300024543FreshwaterHELGAAMHHQLPNHKRTLNLLFHIASGPKKVFVLGQIEPQTPRLVVSFRQYLQVSILQSYFPQNPKPSGFPRNASEPAFEMVSFKA
Ga0256337_104529613300024573FreshwaterMHHQLPNRKRTLNLLLRKASGSGKICVLGQIEPQTPRLVVSLRQFLQVSILQSYSPQNLSPRGFP
Ga0255267_102108313300024867FreshwaterMHHQLPNRKRTLNLLLRKASGSGKICVLSQIEPQTPRLVVSLRQFLQVSILQSYSPQNLSPRGFP
Ga0209098_104317933300025867Anaerobic Digestor SludgeMHHQLPNRKRTLNLLLRKASGSGKICVLSQIEPQTPRLVVSFRQYLQVSVLQPYSPQNPKPSGFPRNASAPAFEMVSFKA
Ga0255289_102337823300026571FreshwaterMHHQLPNRKRTLNLLLRKASGSGKICVLGQIEPQTPRLVVSFRQYLQVSILQSYFPQNPKPCGFPGDASLLARF
Ga0255254_105761113300028105FreshwaterMHHQLPNRKRTLNLLLRKASGSGKICVLRQIEPQTPRLVVSFRQYLQVSILQSYFPQNPKSFGFP
Ga0268283_102453423300028283Saline WaterMHHQLPNHKRTLNLSFRRASGSGKVCVLSQIEPQTPRLVVSLRQYLQVSILQSYSPQNLKPFSFLRVASTIACCLGSNI
Ga0257141_100117513300028623MarineMHHQLPNHKRTLNLSFRRASGSGKVCVLRQIEPQTPRLVVSLRQYLQVSILQSYSPQNLKPFSFLRVASTIACCLGSNI
Ga0257141_101242823300028623MarineMHHQLPNRKRTLNLLLRIASGSGKFCVLGQIEPQTPRLVVIFRQFLQVSVLQPYFPQNLKPSSFLGIASTAPAI
Ga0302205_1000868413300028739FenMHHQLPNRKRTLNLLLRKASGSGKICVLSQIEPQTPRLVVSFRQYLQVSILQSYSPQNPKPSGFPGDASVFARF
Ga0302262_1000561133300028743FenMHHQLPNHKRTLNLLFSKASGSGKICVLSQIEPQTPRLVVSFRQYLQVSILRSYFPQNPKPCGFPRDANICVCF
Ga0302202_1001499743300028762BogMHHQLPNRKRTLNLLLRKASGSGKICVLSQIEPQTPRLVVSLRQYLQVSILQSYFPQNPKAYGFP
Ga0302269_100338723300028766BogMHHQLPNRKRTLNLLLRKASGSVKVCVLSQIEPQTPRLVVSFRQYLQVSVLQPYSPQNSKPSGFPGDATTAASEIVSFKA
Ga0302269_101317423300028766BogMHHQLPNRKRTLNLLLRKASGPGKFCVLSQIEPQTPHLVVFLRQFLQVSILQPYFPQSLKPSGFLGTASVVPAVEMVSFKAQNKTVSDHRLSLHFRP
(restricted) Ga0247841_1005011613300029286FreshwaterMHHQLPNRKRTLNLLLRKASGSGKICVLSQIEPQTPRLVVSFRQYLQVSVLQPYSPQNPKPSGFPGDASGPASEMVSFKA
Ga0311347_1002876213300029923FenMHHQLPNHKRTLNLLFRKASGSGKICVLSQIEPQTPRLVVSFRQYLQVSILRSYFPQNPKPCGFPRDANICVCF
Ga0311365_1002711713300029989FenLPNRKRTLNLLLRKASGSGKICVLSQIEPQTPRLVVSFRQYLQVSILQSYSPQNPKPSGFPGDASVFARF
Ga0311365_1128634213300029989FenRTLNLLLRKASGSGKICVLSQIEPQTPRLVVSFRQYLQVSVLQPYSPQNPKPSGFPGDATNAASEMVSFKA
Ga0311337_1001062953300030000FenMHHQLPNRKRTLNLLLRKASGSGKICVLSQIEPQTPRLVVSFRQYLQVSILQSYFPQNPKPCGFP
Ga0311349_1003016223300030294FenMHHQLPNHKRTLNLLFRKASGSGKICVLSQIEPQTPRLVVSFRQYLQVSILQSYFPQSPKSSGFP
Ga0311349_1049055113300030294FenRKRTLNLLLRKASGSGKICVLSQIEPQTPRLVVSFRQYLQVSVLQPYSPQNPKPSGFPRNASEPAFEMVSFKA
Ga0311360_1052296113300030339BogMHHHLLNHEKTLNLSIGKASRSSEMCVLSQIKPQTPRLVVSLRQYFQVSVLQPYYPQSLKPFDFSGNATRRASRYGGGIV
Ga0302211_1000504023300030491FenMHHQLPNHKRTLNLLFSKASGSGKICVLSQIEPQTPRLVVSFRQYLQVSILRSYFPQNPKPCGFPRDANIYACF
Ga0316219_100714163300031759FreshwaterMHHQLPNHKRTLNLLFRRASGSGKVCVLSQIEPQTPRLVVSLRQYLQVSILQSYSPQNLKPFSFLRVASLLACCLGSNI
Ga0316586_101065223300033527RhizosphereMHHQLPNRKRSLSLLLRKASGSGKICVLSQIEPQTPRLVVSLRQYLQVSDLHPYFPQSLKPFGFLGAVSTCAHCLDGSV
Ga0316596_103374623300033541RhizosphereMHHQLPNRKRTLNLLLRKASGSGKICVLSQIEPQTPRLVVSLRQYLQVSDLHPYFPQSLKPFGFLGAVSTCAHCLDGSV


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.