NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F089876

Metagenome Family F089876

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F089876
Family Type Metagenome
Number of Sequences 108
Average Sequence Length 214 residues
Representative Sequence IEGKKKEMKKSQYREKFDTLAAEIKINLMNTTVSYGTKLYEKSGWGSLVFYNKMANGAYDINVYPQKLTDRDQNRSGVPVSQEPIAFSKIMIATSVLAGKLPDATVIADDKVYGKAMYELWKRNWAMTGGNGGNTLMITYQNLFTYGWAAWRVYPRRVQTKRNGVDKILFDDVYREPLDPTRTWLGIGFNNGDVW
Number of Associated Samples 73
Number of Associated Scaffolds 108

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 1.90 %
% of genes near scaffold ends (potentially truncated) 95.37 %
% of genes from short scaffolds (< 2000 bps) 83.33 %
Associated GOLD sequencing projects 68
AlphaFold2 3D model prediction Yes
3D model pTM-score0.28

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (90.741 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Environmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake
(12.963 % of family members)
Environment Ontology (ENVO) Unclassified
(22.222 % of family members)
Earth Microbiome Project Ontology (EMPO) Unclassified
(31.481 % of family members)


 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      

 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: No Secondary Structure distribution: α-helix: 32.29%    β-sheet: 16.59%    Coil/Unstructured: 51.12%
Feature Viewer
Powered by Feature Viewer

Predicted 3D Structure

Structure Viewer
Per-residue confidence (pLDDT):
  0-50   51-70   71-90   91-100  		pTM-score: 0.28
Powered by PDBe Molstar

Low Quality Model:

This family has a low confidence model (pTM < 0.7) and has not been screened against SCOPe or PDB.

 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 108 Family Scaffolds
PF13392HNH_3 2.78
PF13403Hint_2 1.85
PF11753DUF3310 0.93


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms93.52 %
UnclassifiedrootN/A6.48 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2100351011|ASMM170b_GM97KZC01DH5AUAll Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Dependentiae → unclassified Candidatus Dependentiae → Candidatus Dependentiae bacterium511Open in IMG/M
3300004776|Ga0007800_10076069All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Dependentiae → unclassified Candidatus Dependentiae → Candidatus Dependentiae bacterium810Open in IMG/M
3300004776|Ga0007800_10089517All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Dependentiae → unclassified Candidatus Dependentiae → Candidatus Dependentiae bacterium745Open in IMG/M
3300005039|Ga0068519_1026449All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Dependentiae → unclassified Candidatus Dependentiae → Candidatus Dependentiae bacterium956Open in IMG/M
3300005563|Ga0068855_101601539All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Dependentiae → unclassified Candidatus Dependentiae → Candidatus Dependentiae bacterium666Open in IMG/M
3300005563|Ga0068855_101723373All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Dependentiae → unclassified Candidatus Dependentiae → Candidatus Dependentiae bacterium638Open in IMG/M
3300005911|Ga0075111_1008173All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Dependentiae → unclassified Candidatus Dependentiae → Candidatus Dependentiae bacterium3821Open in IMG/M
3300005915|Ga0075122_10235789All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Dependentiae → unclassified Candidatus Dependentiae → Candidatus Dependentiae bacterium632Open in IMG/M
3300005915|Ga0075122_10276120All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Dependentiae → unclassified Candidatus Dependentiae → Candidatus Dependentiae bacterium568Open in IMG/M
3300005917|Ga0075115_10213729All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Dependentiae → unclassified Candidatus Dependentiae → Candidatus Dependentiae bacterium666Open in IMG/M
3300005918|Ga0075116_10076262All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Dependentiae → unclassified Candidatus Dependentiae → Candidatus Dependentiae bacterium1349Open in IMG/M
3300005935|Ga0075125_10103523All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Dependentiae → unclassified Candidatus Dependentiae → Candidatus Dependentiae bacterium1227Open in IMG/M
3300005935|Ga0075125_10114054All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Dependentiae → unclassified Candidatus Dependentiae → Candidatus Dependentiae bacterium1158Open in IMG/M
3300005935|Ga0075125_10286117All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Dependentiae → unclassified Candidatus Dependentiae → Candidatus Dependentiae bacterium657Open in IMG/M
3300007722|Ga0105051_10110321All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Dependentiae → unclassified Candidatus Dependentiae → Candidatus Dependentiae bacterium2149Open in IMG/M
3300009149|Ga0114918_10108783All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Dependentiae → unclassified Candidatus Dependentiae → Candidatus Dependentiae bacterium1709Open in IMG/M
3300009149|Ga0114918_10268453All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Dependentiae → unclassified Candidatus Dependentiae → Candidatus Dependentiae bacterium964Open in IMG/M
3300009149|Ga0114918_10281406All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Dependentiae → unclassified Candidatus Dependentiae → Candidatus Dependentiae bacterium935Open in IMG/M
3300009149|Ga0114918_10460857Not Available685Open in IMG/M
3300009170|Ga0105096_10774174All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Dependentiae → unclassified Candidatus Dependentiae → Candidatus Dependentiae bacterium512Open in IMG/M
3300009504|Ga0114946_10493437All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Dependentiae → unclassified Candidatus Dependentiae → Candidatus Dependentiae bacterium627Open in IMG/M
3300009692|Ga0116171_10264316All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Dependentiae → unclassified Candidatus Dependentiae → Candidatus Dependentiae bacterium949Open in IMG/M
3300009694|Ga0116170_10137785All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Dependentiae → unclassified Candidatus Dependentiae → Candidatus Dependentiae bacterium1501Open in IMG/M
3300010233|Ga0136235_1015677All Organisms → Viruses → Predicted Viral1814Open in IMG/M
3300010352|Ga0116247_10045292All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Dependentiae → unclassified Candidatus Dependentiae → Candidatus Dependentiae bacterium4229Open in IMG/M
3300011188|Ga0136587_1156017All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Dependentiae → unclassified Candidatus Dependentiae → Candidatus Dependentiae bacterium589Open in IMG/M
3300012031|Ga0136561_1050560All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Dependentiae → unclassified Candidatus Dependentiae → Candidatus Dependentiae bacterium626Open in IMG/M
3300012269|Ga0136560_1041320All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Dependentiae → unclassified Candidatus Dependentiae → Candidatus Dependentiae bacterium1012Open in IMG/M
3300014204|Ga0172381_10189579All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Dependentiae → unclassified Candidatus Dependentiae → Candidatus Dependentiae bacterium1665Open in IMG/M
3300014204|Ga0172381_10872008All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Dependentiae → unclassified Candidatus Dependentiae → Candidatus Dependentiae bacterium671Open in IMG/M
3300014204|Ga0172381_10940506All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Dependentiae → unclassified Candidatus Dependentiae → Candidatus Dependentiae bacterium641Open in IMG/M
3300014205|Ga0172380_10998690All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Dependentiae → unclassified Candidatus Dependentiae → Candidatus Dependentiae bacterium593Open in IMG/M
3300014205|Ga0172380_11143142All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Dependentiae → unclassified Candidatus Dependentiae → Candidatus Dependentiae bacterium547Open in IMG/M
3300014613|Ga0180008_1201495All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Dependentiae → unclassified Candidatus Dependentiae → Candidatus Dependentiae bacterium765Open in IMG/M
3300014656|Ga0180007_10064083All Organisms → Viruses → Predicted Viral2565Open in IMG/M
3300014839|Ga0182027_11770253All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Dependentiae → unclassified Candidatus Dependentiae → Candidatus Dependentiae bacterium598Open in IMG/M
3300020157|Ga0194049_1060348Not Available993Open in IMG/M
3300021473|Ga0194043_1147374All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Dependentiae → unclassified Candidatus Dependentiae → Candidatus Dependentiae bacterium813Open in IMG/M
3300021473|Ga0194043_1239861All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Dependentiae → unclassified Candidatus Dependentiae → Candidatus Dependentiae bacterium592Open in IMG/M
3300022553|Ga0212124_10568457All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Dependentiae → unclassified Candidatus Dependentiae → Candidatus Dependentiae bacterium589Open in IMG/M
3300022851|Ga0222691_1005964All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Dependentiae → unclassified Candidatus Dependentiae → Candidatus Dependentiae bacterium2561Open in IMG/M
3300023241|Ga0222657_1062444All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Dependentiae → unclassified Candidatus Dependentiae → Candidatus Dependentiae bacterium617Open in IMG/M
3300023242|Ga0222708_1041850All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Dependentiae → unclassified Candidatus Dependentiae → Candidatus Dependentiae bacterium660Open in IMG/M
3300023246|Ga0222682_1064486All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Dependentiae → unclassified Candidatus Dependentiae → Candidatus Dependentiae bacterium616Open in IMG/M
3300023256|Ga0222703_1007949All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Dependentiae → unclassified Candidatus Dependentiae → Candidatus Dependentiae bacterium2233Open in IMG/M
3300023257|Ga0222658_1006716All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Dependentiae → unclassified Candidatus Dependentiae → Candidatus Dependentiae bacterium3740Open in IMG/M
3300023297|Ga0222640_1010185All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Dependentiae → unclassified Candidatus Dependentiae → Candidatus Dependentiae bacterium2384Open in IMG/M
3300023297|Ga0222640_1017768All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Dependentiae → unclassified Candidatus Dependentiae → Candidatus Dependentiae bacterium1719Open in IMG/M
3300023297|Ga0222640_1020796All Organisms → Viruses → Predicted Viral1562Open in IMG/M
3300023299|Ga0222702_1115468All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Dependentiae → unclassified Candidatus Dependentiae → Candidatus Dependentiae bacterium503Open in IMG/M
3300023301|Ga0209414_1042006All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Dependentiae → unclassified Candidatus Dependentiae → Candidatus Dependentiae bacterium1317Open in IMG/M
3300025135|Ga0209498_1252982All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Dependentiae → unclassified Candidatus Dependentiae → Candidatus Dependentiae bacterium616Open in IMG/M
3300025380|Ga0208901_1028015All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Dependentiae → unclassified Candidatus Dependentiae → Candidatus Dependentiae bacterium809Open in IMG/M
3300025697|Ga0208769_1018967All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Dependentiae → unclassified Candidatus Dependentiae → Candidatus Dependentiae bacterium2369Open in IMG/M
3300025736|Ga0207997_1199487All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Dependentiae → unclassified Candidatus Dependentiae → Candidatus Dependentiae bacterium605Open in IMG/M
3300025824|Ga0208325_1128777All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Dependentiae → unclassified Candidatus Dependentiae → Candidatus Dependentiae bacterium571Open in IMG/M
3300025855|Ga0209717_1278562All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Dependentiae → unclassified Candidatus Dependentiae → Candidatus Dependentiae bacterium600Open in IMG/M
3300025867|Ga0209098_1084045All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Dependentiae → unclassified Candidatus Dependentiae → Candidatus Dependentiae bacterium1501Open in IMG/M
(restricted) 3300027861|Ga0233415_10337017All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Dependentiae → unclassified Candidatus Dependentiae → Candidatus Dependentiae bacterium716Open in IMG/M
3300027896|Ga0209777_11200839All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Dependentiae → unclassified Candidatus Dependentiae → Candidatus Dependentiae bacterium507Open in IMG/M
3300027899|Ga0209668_10096201All Organisms → cellular organisms → Bacteria1712Open in IMG/M
3300028169|Ga0268279_1156857Not Available587Open in IMG/M
3300028654|Ga0265322_10070177All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Dependentiae → unclassified Candidatus Dependentiae → Candidatus Dependentiae bacterium994Open in IMG/M
3300028763|Ga0302204_1058654All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Dependentiae → unclassified Candidatus Dependentiae → Candidatus Dependentiae bacterium778Open in IMG/M
3300028769|Ga0302213_1096081All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Dependentiae → unclassified Candidatus Dependentiae → Candidatus Dependentiae bacterium830Open in IMG/M
(restricted) 3300029286|Ga0247841_10060028All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Dependentiae → unclassified Candidatus Dependentiae → Candidatus Dependentiae bacterium3449Open in IMG/M
(restricted) 3300029286|Ga0247841_10413938All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Dependentiae → unclassified Candidatus Dependentiae → Candidatus Dependentiae bacterium884Open in IMG/M
(restricted) 3300029286|Ga0247841_10641209All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Dependentiae → unclassified Candidatus Dependentiae → Candidatus Dependentiae bacterium651Open in IMG/M
(restricted) 3300029286|Ga0247841_10880204All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Dependentiae → unclassified Candidatus Dependentiae → Candidatus Dependentiae bacterium522Open in IMG/M
3300030230|Ga0302207_1114568All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Dependentiae → unclassified Candidatus Dependentiae → Candidatus Dependentiae bacterium703Open in IMG/M
3300030943|Ga0311366_10920242All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Dependentiae → unclassified Candidatus Dependentiae → Candidatus Dependentiae bacterium757Open in IMG/M
3300031227|Ga0307928_10051462All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Dependentiae → unclassified Candidatus Dependentiae → Candidatus Dependentiae bacterium2615Open in IMG/M
3300031539|Ga0307380_10404297All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Dependentiae → unclassified Candidatus Dependentiae → Candidatus Dependentiae bacterium1230Open in IMG/M
3300031539|Ga0307380_10675572All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Dependentiae → unclassified Candidatus Dependentiae → Candidatus Dependentiae bacterium875Open in IMG/M
3300031539|Ga0307380_11068921All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Dependentiae → unclassified Candidatus Dependentiae → Candidatus Dependentiae bacterium638Open in IMG/M
3300031539|Ga0307380_11358744Not Available539Open in IMG/M
3300031565|Ga0307379_10585859All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Dependentiae → unclassified Candidatus Dependentiae → Candidatus Dependentiae bacterium1025Open in IMG/M
3300031565|Ga0307379_11282085All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Dependentiae → unclassified Candidatus Dependentiae → Candidatus Dependentiae bacterium601Open in IMG/M
3300031565|Ga0307379_11417731All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Dependentiae → unclassified Candidatus Dependentiae → Candidatus Dependentiae bacterium559Open in IMG/M
3300031566|Ga0307378_10404393All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Dependentiae → unclassified Candidatus Dependentiae → Candidatus Dependentiae bacterium1253Open in IMG/M
3300031578|Ga0307376_10071939All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Dependentiae → unclassified Candidatus Dependentiae → Candidatus Dependentiae bacterium2471Open in IMG/M
3300031578|Ga0307376_10116081All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Dependentiae → unclassified Candidatus Dependentiae → Candidatus Dependentiae bacterium1873Open in IMG/M
3300031578|Ga0307376_10238627All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Dependentiae → unclassified Candidatus Dependentiae → Candidatus Dependentiae bacterium1230Open in IMG/M
3300031578|Ga0307376_10475096All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Dependentiae → unclassified Candidatus Dependentiae → Candidatus Dependentiae bacterium812Open in IMG/M
3300031601|Ga0307992_1247042All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Dependentiae → unclassified Candidatus Dependentiae → Candidatus Dependentiae bacterium641Open in IMG/M
3300031601|Ga0307992_1256804All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Dependentiae → unclassified Candidatus Dependentiae → Candidatus Dependentiae bacterium624Open in IMG/M
3300031601|Ga0307992_1303309All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Dependentiae → unclassified Candidatus Dependentiae → Candidatus Dependentiae bacterium555Open in IMG/M
3300031601|Ga0307992_1305699All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Dependentiae → unclassified Candidatus Dependentiae → Candidatus Dependentiae bacterium551Open in IMG/M
3300031673|Ga0307377_10483917All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Dependentiae → unclassified Candidatus Dependentiae → Candidatus Dependentiae bacterium904Open in IMG/M
3300031772|Ga0315288_11741948All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Dependentiae → unclassified Candidatus Dependentiae → Candidatus Dependentiae bacterium500Open in IMG/M
3300031918|Ga0311367_11609657All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Dependentiae → unclassified Candidatus Dependentiae → Candidatus Dependentiae bacterium635Open in IMG/M
3300031952|Ga0315294_10452973All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Dependentiae → unclassified Candidatus Dependentiae → Candidatus Dependentiae bacterium1186Open in IMG/M
3300031952|Ga0315294_11348955All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Dependentiae → unclassified Candidatus Dependentiae → Candidatus Dependentiae bacterium568Open in IMG/M
3300031999|Ga0315274_12084662All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Dependentiae → unclassified Candidatus Dependentiae → Candidatus Dependentiae bacterium506Open in IMG/M
3300032046|Ga0315289_10096460All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Dependentiae → unclassified Candidatus Dependentiae → Candidatus Dependentiae bacterium3487Open in IMG/M
3300032046|Ga0315289_11399784All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Dependentiae → unclassified Candidatus Dependentiae → Candidatus Dependentiae bacterium543Open in IMG/M
3300032053|Ga0315284_10286026All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Dependentiae → unclassified Candidatus Dependentiae → Candidatus Dependentiae bacterium2084Open in IMG/M
3300032053|Ga0315284_11570422All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Dependentiae → unclassified Candidatus Dependentiae → Candidatus Dependentiae bacterium694Open in IMG/M
3300032053|Ga0315284_11959612All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Dependentiae → unclassified Candidatus Dependentiae → Candidatus Dependentiae bacterium596Open in IMG/M
3300032118|Ga0315277_11844874All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Dependentiae → unclassified Candidatus Dependentiae → Candidatus Dependentiae bacterium500Open in IMG/M
3300032177|Ga0315276_11872887All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Dependentiae → unclassified Candidatus Dependentiae → Candidatus Dependentiae bacterium615Open in IMG/M
3300032516|Ga0315273_10479146All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Dependentiae → unclassified Candidatus Dependentiae → Candidatus Dependentiae bacterium1668Open in IMG/M
3300032516|Ga0315273_11741208All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Dependentiae → unclassified Candidatus Dependentiae → Candidatus Dependentiae bacterium753Open in IMG/M
3300033233|Ga0334722_10247757All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Dependentiae → unclassified Candidatus Dependentiae → Candidatus Dependentiae bacterium1309Open in IMG/M
3300034257|Ga0370495_0007750All Organisms → cellular organisms → Bacteria → Bacteria incertae sedis → Bacteria candidate phyla → Candidatus Dependentiae → unclassified Candidatus Dependentiae → Candidatus Dependentiae bacterium3192Open in IMG/M

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).


 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
SedimentEnvironmental → Aquatic → Freshwater → Lake → Sediment → Sediment12.96%
Saline LakeEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake12.96%
SoilEnvironmental → Terrestrial → Soil → Clay → Unclassified → Soil12.04%
Saline WaterEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Water11.11%
FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Freshwater5.56%
Landfill LeachateEngineered → Solid Waste → Landfill → Unclassified → Unclassified → Landfill Leachate5.56%
FenEnvironmental → Terrestrial → Peat → Unclassified → Unclassified → Fen4.63%
Anaerobic Digestor SludgeEngineered → Wastewater → Anaerobic Digestor → Unclassified → Unclassified → Anaerobic Digestor Sludge4.63%
Deep SubsurfaceEnvironmental → Aquatic → Marine → Oceanic → Sediment → Deep Subsurface3.70%
MarineEnvironmental → Aquatic → Marine → Unclassified → Unclassified → Marine3.70%
Anoxic Zone FreshwaterEnvironmental → Aquatic → Freshwater → Lake → Unclassified → Anoxic Zone Freshwater2.78%
SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment1.85%
FreshwaterEnvironmental → Aquatic → Freshwater → Lentic → Unclassified → Freshwater1.85%
Freshwater Lake SedimentEnvironmental → Aquatic → Freshwater → Lentic → Sediment → Freshwater Lake Sediment1.85%
GroundwaterEnvironmental → Aquatic → Freshwater → Groundwater → Unclassified → Groundwater1.85%
Saline LakeEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Saline → Unclassified → Saline Lake1.85%
Corn RhizosphereHost-Associated → Plants → Rhizoplane → Epiphytes → Unclassified → Corn Rhizosphere1.85%
Freshwater SedimentEnvironmental → Aquatic → Freshwater → Sediment → Unclassified → Freshwater Sediment0.93%
FreshwaterEnvironmental → Aquatic → Freshwater → Lotic → Unclassified → Freshwater0.93%
FreshwaterEnvironmental → Aquatic → Freshwater → Ice → Glacial Lake → Freshwater0.93%
SeawaterEnvironmental → Aquatic → Marine → Inlet → Unclassified → Seawater0.93%
Coastal Water And SedimentEnvironmental → Aquatic → Marine → Neritic Zone → Unclassified → Coastal Water And Sediment0.93%
HypersalineEnvironmental → Aquatic → Non-Marine Saline And Alkaline → Hypersaline → Unclassified → Hypersaline0.93%
Untreated Peat SoilEnvironmental → Terrestrial → Soil → Wetlands → Unclassified → Untreated Peat Soil0.93%
FenEnvironmental → Terrestrial → Soil → Wetlands → Permafrost → Fen0.93%
RhizosphereHost-Associated → Plants → Rhizosphere → Soil → Unclassified → Rhizosphere0.93%
WastewaterEngineered → Wastewater → Unclassified → Unclassified → Unclassified → Wastewater0.93%

Visualization
Powered by ApexCharts



Associated Samples

Note: Some of these datasets are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Taxon OIDSample NameHabitat TypeIMG/M Link
2100351011Marine sediment microbial communities from Arctic Ocean, off the coast from Alaska - sample from medium methane PC12-240-170cmEnvironmentalOpen in IMG/M
3300004776Freshwater microbial communities from Crystal Bog, Wisconsin, USA - MA14MEnvironmentalOpen in IMG/M
3300005039Wastewater microbial communities from Nanji, Korea with extracellular vesicles - Nanji-3umEngineeredOpen in IMG/M
3300005563Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2Host-AssociatedOpen in IMG/M
3300005911Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UKKEnvironmentalOpen in IMG/M
3300005915Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UKBEnvironmentalOpen in IMG/M
3300005917Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UKHEnvironmentalOpen in IMG/M
3300005918Saline lake microbial communities from Ace Lake, Antarctica- Antarctic Ace Lake Metagenome 02UKCEnvironmentalOpen in IMG/M
3300005935Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UKNEnvironmentalOpen in IMG/M
3300007722Freshwater microbial communities from Lake Fryxell liftoff mats and glacier meltwater in Antarctica - FRY-02 (megahit assembly)EnvironmentalOpen in IMG/M
3300009149Deep subsurface microbial communities from Baltic Sea to uncover new lineages of life (NeLLi) - Landsort_02402 metaGEnvironmentalOpen in IMG/M
3300009170Freshwater sediment microbial communities from Prairie Pothole Lake near Jamestown, North Dakota, USA - PPLs Lake P7 Core (1) Depth 1-3cm May2015EnvironmentalOpen in IMG/M
3300009504Lake sediment microbial communities from Walker lake, Nevada to study Microbial Dark Matter (Phase II) - Walker Lake 11/02/13 Deep SedimentEnvironmentalOpen in IMG/M
3300009692Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNHW2_MetaGEngineeredOpen in IMG/M
3300009694Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNHW1_MetaGEngineeredOpen in IMG/M
3300010233Filterable freshwater microbial communities from Conwy River, North Wales, UK. Fraction, filtered through 0.2 um filter. After WGA.EnvironmentalOpen in IMG/M
3300010352AD_JPHWcaEngineeredOpen in IMG/M
3300011188Saline lake microbial communities from Rauer Islands, Antarctica - Metagenome Filla 1 #563EnvironmentalOpen in IMG/M
3300012031Saline lake microbial communities from Rauer Islands, Antarctica - Metagenome Hop E1 #498EnvironmentalOpen in IMG/M
3300012147Saline lake microbial communities from Rauer Islands, Antarctica - Metagenome Filla 1 #564EnvironmentalOpen in IMG/M
3300012269Saline lake microbial communities from Rauer Islands, Antarctica - Metagenome Hop E1 #497EnvironmentalOpen in IMG/M
3300014204Leachate microbial communities from a municipal landfill in Southern Ontario, Canada - Leachate well 64-88 metaGEngineeredOpen in IMG/M
3300014205Leachate microbial communities from a municipal landfill in Southern Ontario, Canada - Leachate well 162 metaGEngineeredOpen in IMG/M
3300014613Groundwater microbial communities from the Aspo Hard Rock Laboratory (HRL) deep subsurface site, Sweden - MM_PW_MetaGEnvironmentalOpen in IMG/M
3300014656Groundwater microbial communities from the Aspo Hard Rock Laboratory (HRL) deep subsurface site, Sweden - MM_PC_MetaGEnvironmentalOpen in IMG/M
3300014839Permafrost microbial communities from Stordalen Mire, Sweden - 712E1D metaG (Illumina Assembly)EnvironmentalOpen in IMG/M
3300020157Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L224-25mEnvironmentalOpen in IMG/M
3300021473Anoxic zone freshwater microbial communities from boreal shield lake in IISD Experimental Lakes Area, Ontario, Canada - Jun2016-L442-15mEnvironmentalOpen in IMG/M
3300022553Powell_combined assemblyEnvironmentalOpen in IMG/M
3300022851Saline water microbial communities from Ace Lake, Antarctica - #1237EnvironmentalOpen in IMG/M
3300023241Saline water microbial communities from Ace Lake, Antarctica - #474EnvironmentalOpen in IMG/M
3300023242Saline water microbial communities from Ace Lake, Antarctica - #1576EnvironmentalOpen in IMG/M
3300023246Saline water microbial communities from Ace Lake, Antarctica - #1008EnvironmentalOpen in IMG/M
3300023256Saline water microbial communities from Ace Lake, Antarctica - #1506EnvironmentalOpen in IMG/M
3300023257Saline water microbial communities from Ace Lake, Antarctica - #476EnvironmentalOpen in IMG/M
3300023297Saline water microbial communities from Ace Lake, Antarctica - #187EnvironmentalOpen in IMG/M
3300023299Saline water microbial communities from Ace Lake, Antarctica - #1504EnvironmentalOpen in IMG/M
3300023301Hypersaline microbial communities from Lake Vida, Antarctica - Brine Hole Two >0.2 micron (SPAdes)EnvironmentalOpen in IMG/M
3300025135Lake sediment microbial communities from Walker lake, Nevada to study Microbial Dark Matter (Phase II) - Walker Lake 11/02/13 Deep Sediment (SPAdes)EnvironmentalOpen in IMG/M
3300025380Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UKF (SPAdes)EnvironmentalOpen in IMG/M
3300025697Saline lake microbial communities from Ace Lake, Antarctica- Antarctic Ace Lake Metagenome 02UKC (SPAdes)EnvironmentalOpen in IMG/M
3300025736Saline lake microbial communities from Ace Lake, Antarctica - Antarctic Ace Lake Metagenome 02UKN (SPAdes)EnvironmentalOpen in IMG/M
3300025824Freshwater microbial communities from Powell Lake, British Columbia, Canada to study Microbial Dark Matter (Phase II) - PL_2010_330m (SPAdes)EnvironmentalOpen in IMG/M
3300025855Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from USA - AD_UKC048_MetaG (SPAdes)EngineeredOpen in IMG/M
3300025867Active sludge microbial communities of municipal wastewater-treating anaerobic digesters from Japan - AD_JPNHW1_MetaG (SPAdes)EngineeredOpen in IMG/M
3300027861 (restricted)Seawater microbial communities from Saanich Inlet, British Columbia, Canada - Na_anoxic_12_MGEnvironmentalOpen in IMG/M
3300027896Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies -HBP12 HB (SPAdes)EnvironmentalOpen in IMG/M
3300027899Freshwater lake sediment microbial communities from the University of Notre Dame, USA, for methane emissions studies - PLP11 PL (SPAdes)EnvironmentalOpen in IMG/M
3300028169Saline water microbial communities from Sakinaw Lake, British Columbia, Canada - sak_2010_1_5_80mEnvironmentalOpen in IMG/M
3300028654Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaGHost-AssociatedOpen in IMG/M
3300028763Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_E1_1EnvironmentalOpen in IMG/M
3300028769Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_N1_1EnvironmentalOpen in IMG/M
3300029286 (restricted)Freshwater microbial communities from meromictic Lake La Cruz, Castile-La Mancha, Spain - LaCruzMarch2015_18mEnvironmentalOpen in IMG/M
3300030230Peat permafrost microbial communities from Stordalen Mire near Abisko, Sweden - II_Fen_E2_2EnvironmentalOpen in IMG/M
3300030943III_Fen_N2 coassemblyEnvironmentalOpen in IMG/M
3300031227Saline water microbial communities from Ace Lake, Antarctica - #232EnvironmentalOpen in IMG/M
3300031539Soil microbial communities from Risofladan, Vaasa, Finland - UN-3EnvironmentalOpen in IMG/M
3300031565Soil microbial communities from Risofladan, Vaasa, Finland - UN-2EnvironmentalOpen in IMG/M
3300031566Soil microbial communities from Risofladan, Vaasa, Finland - UN-1EnvironmentalOpen in IMG/M
3300031578Soil microbial communities from Risofladan, Vaasa, Finland - TR-2EnvironmentalOpen in IMG/M
3300031601Marine microbial communities from Ellis Fjord, Antarctic Ocean - #133EnvironmentalOpen in IMG/M
3300031673Soil microbial communities from Risofladan, Vaasa, Finland - TR-3EnvironmentalOpen in IMG/M
3300031772Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_20EnvironmentalOpen in IMG/M
3300031918III_Fen_N3 coassemblyEnvironmentalOpen in IMG/M
3300031952Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G13_40EnvironmentalOpen in IMG/M
3300031999Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_20EnvironmentalOpen in IMG/M
3300032046Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G11_40EnvironmentalOpen in IMG/M
3300032053Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G09_16EnvironmentalOpen in IMG/M
3300032118Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_15EnvironmentalOpen in IMG/M
3300032177Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G05_0EnvironmentalOpen in IMG/M
3300032516Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - YL17G02_0EnvironmentalOpen in IMG/M
3300033233Sediment microbial communities from Yellowstone Lake, YNP, Wyoming, USA - C3_bottomEnvironmentalOpen in IMG/M
3300034257Peat soil microbial communities from wetlands in Alaska, United States - Frozen_pond_02D_17EnvironmentalOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap


 ⦗Top⦘

Family Sequences

Note: Some of these sequences are restricted, as per the data usage policy of the Joint Genome Institute (JGI). Utilizing any of their features below requires obtaining a license from the datasets' corresponding author(s).

Protein ID Sample Taxon ID Habitat Sequence
ASMM170b_002286802100351011Coastal Water And SedimentMVKKYYEKSGWGSMVFYNKMADGSYDVNVYPQKLTDRDQNRSGVPISQEPIAFSKIMIATSVLAGKLPDGKVVADDKVYAKASYELWKRNWSMTGANGENTLMLTYQNLFTYGWAAWRVYPRRVQVPRKGVQKIMFDDIYREPLEVTRTWLG
Ga0007800_1007606913300004776FreshwaterMTSPQDEKTDAVKFIADKKKEMKKSQYRERFDTLAAEIGINLMNTNVSYGQKLYEKSGWGSMVFYNKMANGAYDINVYPQKLTDRDQNRSGVPVSQEPIAFSKILIAASVLGGKLPDATVVADDKVYAKASYELWKRSWSMQGGNGANTLGLTYQNLFTYGWAAWRVYPRRVQTQRKGVTKIMFDDVYREPMDCRRTWLGIGFNHGDCWSWGEAYYERDMQKEEFYRMYPEAKKNKRKLEYCSVSEESKDENSEKAHTSVTIGYYENYL
Ga0007800_1008951713300004776FreshwaterMPITKNKETLTFILEKKKEMKKSQFREKFDALAAEININLINTTVSYGTKLYEKSGWGSMVFYNKMANGAYDINVYPQKLTDRDQNRSGVPVSQEPIAFSKILIATSVLAGKLPDAKVVADDKVYAKAMYELWKRNWSMTGANGQNTLMLTYQNLFTYGWDAWRVYPRRVQVKRNGVDKILFDDIYREPLDCTRTWLGIGFNNGDVWSQSEVYYEKDMPKADFFEMYPEALKN
Ga0068519_102644913300005039WastewaterMDEDNLGVGNSKPTEDDGTAIPKAVKSMDTPDAKATVEFVEEKKKQMKESQYRRRFDELSREISMNIVNTTVSYGEKVYEKTGWGSMVFYNKMDNGGYDINVYPQKLTNRDQNRSGVPVSQEPIAFSKILIATSVLAGKVPDAEVIGDDKIYNKAAHDLWARTWTLKGANGQNTLERTYQNLLTYGWAAWRTYPRRVSVKRNGIDKILFDDIYREPMDPDRTWLGVGQSVGDYWSAFEVYYEKDILKDEFFRMCPEAAEY
Ga0068855_10160153913300005563Corn RhizosphereNETPTQADGTTPPKQVKPMDTPDAKATVKFVEEKKRLMKRSQYRERFDELSREIKQNIVNTTVSYGEKTYEKTGWGSMVFYNKLSNGSYDINVYPQKLTDRNQNRSGVPVSQEPIAFSKILIATSVLAGKVPDAEVIGDDKVFNKAAYELWKRTWTLKGANGQNTLERTYQNLLTYGWAAWRTYPRRIAVKRNGIDKIIFDDIYREPMDPDRTWLGIAQNP
Ga0068855_10172337313300005563Corn RhizosphereEIQMNLVNTMVSYGQKLYEKSGWGSMVFYNRMANGAYDINVYPQKLTDRDQNRSGVPVSQEPIAFSKIMIATSVLAGKLPDAEVLADDKVYARACYELWKRNWSLKGGNGQNTMEIVYQNDLTYGWAAWRVYPRRVQVKRNGVDKILFDDIYREPLDPSRTWLGLGFNHGDYWSKFEIYYEKDMPKSEFFEKYPQALAQKNLLEYCSLSEEA
Ga0075111_100817323300005911Saline LakeMSKTTLKGDKETIDFIEEKKREMKKSQYRQKFDALAAEINQNLMATAVSYGNKLYEKSGWGSMVFYNKMASGAYDINVYPQKVTDRDKNNSGVPVSQEPIAFSKIMIATSVLAGKLPDGKVIADDKVYGKAMYELWKRNWSMTGGNGSNTLMLTYQNLFTYGWAAWRVYPRRVQVKRNGVERYCSMIYIENL*
Ga0075122_1023578913300005915Saline LakeMAKTETKEEKKTIDFIEGKKNEMKKSKYRVKFDALASEIDNNLINTMVSYGEKLYEQSGWGSMVFYNKMANGSYDINVYPQKATGAGKNNSGVPVSQEPIAFSKIIIATSVLAGKLPDAKVVADDKVYGKAMYELWKRNWSMTGANGSNTLMLTYQNIFTYGWAAWRVYPRRV
Ga0075122_1027612013300005915Saline LakeKTIAFIDDKKIEMKKSQYREKFDALASEIGQNIMCTGVSYGQKLYEKSGWGSMVFYNKMASGAYDINVYPQKLTDRDQNKSGVPVSQEPIAFSKIMIATSVLAGKLPDAQVVADDKVYAKAMYELWKRNWSMTGANGENTLMLTYQNLFTYGWAAWRVYPRRVQTKRNGVDKILFDDIYREPLECTRTW
Ga0075115_1021372913300005917Saline LakeMTKTTLKGDKKTINFIEEKKREMKKSQYRQKFDALANEIDQNLMATSVSYGNKLYEKSGWGSMVFYNKMASGAYDINVYPQKVTDRDQNNSGVPVSQEPIAFSKIMIATSVLAGKLPDGKVIADDKVYGKAMYELWKRNWSMTGANGSNTLMLTYQNLFTYGWAAWRVYPRRVQVK
Ga0075116_1007626213300005918Saline LakeMEDEKKTKLKGDKKTIAFIDDKKIEMKKSQYREKFDALASEIGQNIMCTGVSYGQKLYEKSGWGSMVFYNKMASGAYDINVYPQKLTDRDQNKSGVPVSQEPIAFSKIMIATSVLAGKLPDAQVVADDKVYAKAMYELWKRNWSMTGANGENTLMLTYQNLFTYGWAAWRVYPRRVQTKRNGVDKILFDDIYREPLECTRTWLGVGFNNGDIWSQTEVYYEKDMPKDEFFAMYPEAKKNKKKLQYISVSKEAKDENSEKAHTSVTI
Ga0075125_1010352323300005935Saline LakeMAKKLTGDKETINFIEEKKKEMKKSQYRVKFDALASEINANLVNTTVSYGKKLYEKSGWGSTTFYNKQSDGSYDYNVYPQKIAGLDQNKSGVPIAQEPIAFSKILIATSVLAGKLPDAKVIADDKVYGKAMYELWKRNWSMTGGNGGNTLMLTYQNLFTYGWAAWRVYPRRVQVKRKGVDKILFDDIYREPMDCTRTWLGIGFNNGDVWSQTEAYYEKDMTKEEFFDKYPAAKKDKKKLEYVAVSDESKDENSEKINTSVTIGYYENELTNRYVVTCG
Ga0075125_1011405413300005935Saline LakeMEVEKKLALKNDKATIKFVEDKKIEMKKSQYRVKFDALASEIQQNIMNTSVSYGTKLYEKSGWGSMVFYNKMANGAYDINVYPQKLTDRDQNRSGVPASQEPIAFSKIMIATSVLAGKLPDAKVIADDKVYGKAMYELWKRNWSMTGANGENTLMLTYQNLFTYGWAAWRVYPRRVQVKRNGVDKILFDDIYREPLEC
Ga0075125_1028611713300005935Saline LakeEDKKKEMKNSQYRTKFDLLSREVSQNLMNTTVGYGNKLYEKSGWGSMVMYNRMADGSYDINVYPNKLSGQDQNKSGVPSSQEPIAFSKIIIATSVLAGKLPDAQTIADDKVYARAMYELWKRNWSMTGANGENTLMLTYQNLFTYGWAAWRVYPRRVQVKRNGVDKILFDDIYREPLDCTRTWLGIGFNNGDVWSQSEVYYEKDMPKEEFFKMYPGAE
Ga0105051_1011032123300007722FreshwaterMAKLTPEDKIVIDFVEEKKKEMKKSQYREKFDALSSEISINLVNTSVSYGQKLYEKSGWGSMMFYNRMSNGAYDINVYPQKLNDRDQNRSGVPVSQEPIAFSKIMIATSVLAGKLPDAEVFADDKVYARAMYELWRRGWALSGANGENTMMLVYQNLFTYGWAAWRVYPRRVQVKRKGVDKILFDDI
Ga0114918_1010878323300009149Deep SubsurfaceMNKTTSKEDKNTIIFIEDKKKEMKKSIYRTKFDNLAKEIEKNLMATTVGYGKKLYETSGWGSMVMYNKMANGAYDINVYPHKTSGMDKNDSGVPVSQEPIAFSKIMIATSVLAGKLPDGKVIADDKVYAKACYELWKRNWSMTGGNGGNTLMLTYQNLFTYGWAAWRVYPRRVQV
Ga0114918_1026845313300009149Deep SubsurfaceMAKKKKNDKDTVQFIADKKEEMKKSQYRVRFDALAAEIKQNIMNTSVSYGQKLYEKSGWGSMMFYNKQADGSYDINVYPQKLTDRDQNRSGVPVSQEPIAFSKIIIATSVLAGKLPDARVIADNKVYARASYELWKRSWSMTGGNGENTLMLTYQNLFTYGWAAWRVYPRRVQVPRNGTTKILFDDIYREPLDCNRTWLGVGFNNGDVWSQTERYYEKDLSKDDFFVMYPEAKKNKKKLQYVNVSEEASDENNEKPHT
Ga0114918_1028140613300009149Deep SubsurfaceMEIEKQSPLKGDKKTIEFIEEKKKEMKKSQYRERFDALAAEIQQNIMNTSVSYGQKLYEKSGWGSMVFYNKMANGAYDINVYPQKLTDRDQNRSGVPVAQEPIAFSKIMIATSVLAGKLPDAKVVADDKVYAKAMYELWKRNWSMTGANGGNTLMLTYQNLFTYGWAAWRVYPRRVQVTRNGVDKILFDDIYREP
Ga0114918_1046085713300009149Deep SubsurfaceMNTNDTFLESKANGKSKDKRTIEYITQKKQDMKKSQYRVKFDTLLKEINQNLVNTEVSYGQKLYEKSGWGSMVFYNKMANGAYDINVYPQKMNDRGQNSSGVPVSQEPIAFSKIMIATSVLAGKLPDAQMIADDKVYAKAMYELWKRTWSMVGGNGGNTLMLTYQN
Ga0105096_1077417413300009170Freshwater SedimentGQKLYEKSGWGSMVFYNKMANGAYDINVYPQKLTDRDQKRSGVPVSAEPIAFSKIMIATSVLAGKLPDATVVADDKIYAKAMYELWKRNWSMTGANGSNTLMLTYQNLFTYGWAAWRVYPRRVQVKRNGVDKILFDDIYREPLDCTRTWLGIGFNNGDVWSQTEVYYEKD
Ga0114946_1049343713300009504SedimentEKIYEKSGWGSMVFYNKLSNGAYDINVYPNKTSNVDKNKSGVPTSAEPIAFSKILIAASVLGGKLPDAQVIADDKVYARASYELWKRSWTMTGGNGANTLGLTYQNLFTYGWAAWRVYPRRVSVKRNGVDKIMFDDIYREPLNVKRTWLGIGFNHGDCWSWGEVYYERDMPKEDFYRMYPEAKSKKNKAKLEYCSVSEEAKDENNEKA
Ga0116171_1026431623300009692Anaerobic Digestor SludgeMAKLTTDDKKTIEFIENKKKEMKKSQYREKFDALAAEIEINLINTNVTYGQKLYEKSGWGSMVFYNKMANGAYDINVYPQKLTDRDQNRSGVPVSQEPIAFSKIMIATSVLAGKLPDATVIADDKVYAKAMYELWKRSWSMNGANGANTLMLVYQNMFTYGWAGWRVYPRRVSVKRNGVDKIIFDDIYREPLDPRRTWLGLGYNHGDFWSWGEVYYEKDMPKD
Ga0116170_1013778533300009694Anaerobic Digestor SludgeMAKLTTDDKKTIEFIENKKKEMKKSQYREKFDALAAEIEINLINTNVTYGQKLYEKSGWGSMVFYNKMANGAYDINVYPQKLTDRDQNRSGVPVSQEPIAFSKIMIATSVLAGKLPDATVIADDKVYAKAMYELWKRSWSMNGANGANTLMLVYQNMFTYGWAGWRVYPRRVSVKRNGVDKIIFDDIYREPLDPRRTWLGLGYNHGDFWSWGEVYYEKDMPKDEFYEKYPEAKKNKKLLDLCSVSEEAKDENR
Ga0136235_101567713300010233FreshwaterMDPSTLKKDQTPIDSTPKVKKSTTSEKETVEFILERKKEMKKSQYRNRFDTIAAEIGINLVNTQVSYGQKLYEKSGWGSMVFYNKMANGAYDINVYPQKPIAFSKIMIAASVLGGKLPDATVIADDKIYAKAMHELWKRSWSMAGANGSNTLLTSYQNLFTYGWTAWRTYPRRIEVPKNGAKKLRFDDIYREPLDVKRTWLGIGFCN
Ga0116247_1004529213300010352Anaerobic Digestor SludgeMAKIKKEDRKTLEFLKMKKDQMKKSQYRVRFDALVKDIKKNLINTTVSYGEKIQEQSGWASTVFYNKQSDGSYDINVYPQKMTTNNNNGSSVPSFQEPIAFSKILIATSVLAGKLPDATVLADDKIYAKSMYELWKRTWSMVGGNGANTLMIVYQNLLTYGWGAWRIYPRRVQVPRKGTTKILFDDIYREP
Ga0136587_115601713300011188Saline LakeFDGLSREISENIINTTVEYGTKIQEKTGWGSMVFYSKMANGGYDINVYPQKVGESKNNQSGVPVSQEPIALSKILIATSVLAGKVADAQVVGDDKVYNKAAYELWKRTWTLKGGNGQNTLERTYQNLLTYGWAAWRTYPRRVAVKRKGIDKILFDDVYREPMDPDRTWLGIGQNVGDYWSAFEVYYEKDILKDEF
Ga0136561_105056013300012031Saline LakeTVSEKDKASYIFVEDKKKLMKKSQYRQRFDELYKEIEANIINTTVSYGKKVYEETGWGSMVFYNKMSNGAYDINVYPQKINGQNADKSGVPVSQEPIALSKILIATSVLAGKVPDCEVIGDDKIYNKAAYELWKRTWSLKGGNGQNTLERTYQNLFTCGWAAWRVYPRRVSVKRKGIDKILFDDVYREPMDPARTWLGVGQNVGDYWS
Ga0136561_105788313300012031Saline LakeKYEKSGWGSMVFYNKMANGGYDINVYPHKSPDQNQSQSGVPVSQEPIALSKILIATSVLAGKVPDAQVIGDDKVYNKAAYELWKRTWTLKGANGQNTLERTYQNLLTYGWAAWRTYPRRVSVKRKGIDKILFDDVYREPMDPDRTWLGVGQNVGDYWSAFEVYYEKDILKDEFFKMVPEAEEHKKKRKY
Ga0136588_106389413300012147Saline LakeENKKKLMKESQYRTRFDGLSREISENIINTTVEYGKKIQEKTGWGSMVFYSKMANGGYDINVYPQKVGESKNNQSGVPVSQEPIALSKILIATSVLAGKVPDAQVVGDDKVYNKAAYELWKRTWTLKGGNGQNTLERTYQNLLTYGWAAWRTYPRRVAVKRKGIDKILFDDVYREPMDPDRTWLGIGQNVG
Ga0136560_104132013300012269Saline LakeMYKNTDSPEETELLGGESTSSATKKKTVSAEDKASYIFVEDKKKLMKESQYRKRFDELSKEIESNIINTTVSYGKKVYEETGWGSMVFYNKMSNGAYDINVYPQKINGQNDNKSGVPVSQEPIALSKILIATSVLAGKVPDCEVVGDDKVYNKAAHELWKRTWTLKGGNGQNTLERTYQNLFTYGWAAWRTYPRRVSVKRKGIDKILFDDIYREPMDPARTWFGIGQNVGD
Ga0172381_1018957913300014204Landfill LeachateMAENMTPVATDSMTSPKEEKKDTIKFIADKKKEMKKSQYRERFDTLAAEIGINLVNTNVSYGQKLYEKSGWGSMVFYNKMANGAYDINVYPQKLTDRDQNRSGVPVSQEPIGFAKILIAASVLGGKLPDATAVADNKVYARASYELWKRSWSMQGGNGSNTLGLTYQNLFTYGWAAWRVYPRRVQTQRKGVTKILFDDIYREPMDCRRTWLGIGFNHGDCWSWGEAY
Ga0172381_1087200813300014204Landfill LeachateMDFEQKTKLRGDKATVEFIEEKKKEMLKSQYREKFDSLAREIQMNLLNTTVSYGQKLYEKTGWGSMVFYNKQANGSYDYNIYPQKLTDRDQNRSGVPVSQEPVAFSKIMIATSVLAGKLPDATVVADDKVYAKAMYELWKRNWAMTGGNGANTLMITYQNLFTYGWAAWRVYPRRVQAKRNGVDKILFDDVYREPLDCTRTWLGIGFNNGDVWSQTE
Ga0172381_1094050613300014204Landfill LeachateQYREKFDALAAEISINLINTSVQYGQKLYEKSGWGSMVFYNKMANGAYDMNVYPMKLTDRDQNRSGVPISQEPIAFSKVIIAASVLGGHLPNATVLADDKVWAKAMYDLWKRTWIMDGGNGENTLGLVFQTLLTYGWAAWRVYPRRVQNQRKGVTKILFDDIYREPLDVTRTWLGLGANHGDYWSWGEVYYEKDMTKEEFFLKYPDSAKEKKK
Ga0172380_1050372413300014205Landfill LeachateMNDEMEVSNSKPTLDDGTNPKKTGKNSSSESDKAAYAFVENKKKNMKKSQYRERFDALASEIDLNIINTTVSYGEKIYEKTGWGSMVMYNKMSNGAYDINVYPQKIADRDQNRSGVPVSQEPIALSKILIATSVLAGKVPDAEVICDDKVYGKAAYELWKRTWYLKGANGQSTLERSYQNLLTYGWMAFRTYPRRVAVKRNGIDKILFDDIYREPMD
Ga0172380_1099869013300014205Landfill LeachateQKLYEKSGWGSMVFYNRMANGAYDINVYPQKLSDRDQNRSGVPVSQEPIAFSKIMIATSVLAGKLPDAEVLADDKVYARAMYELWKRNWELKGANGENTMMMVYQNLFTYGWAAWRVYPRRVQVKRNGVDKILFDDIYREPLDPTRTWIGIGFNHGDYWSQMEVYYERDMPKSEFFEKYPQALAQKKLLEYCSVSEE
Ga0172380_1114314213300014205Landfill LeachateADKKTIEYIENKKKEMKKSQYREKFDALCSEIETNLVNTNVSYGQKLYEKSGWGSMVFYNKMANGAYDINVYPQKLTDRDQNRSGVPLSQEPIAFAKILIATSVLAGKLPDAEVVADDKVYARAVYELWKRGWALTGGNGANTLMMVYQNLFTYGWAAWRVYPRRVQVKRKGVDKILFDD
Ga0180008_120149513300014613GroundwaterEDKKKAMKKSQYREKFDALASEISTNLMDTAVSYGQKLYEKSGWGSLVTYNKMANGSYDINVYPQKLSGRDQNRSGVPVSQEPIAFSKIMIATSVLAGKLPDATVIADDKIYAKAMYELWKRNWAMTGANGSNTLMLTYQNLFTYGWAAWRVYPRRVQVKRNGVDKILFDDVYREPLDVTRTWLGLGFTNGDYWSQFEVYYEKDMLKDEFYDKYPEAEKNKKKLEYCSTSKEANDENTEKIHTHVTIGYYENTIL
Ga0180007_1006408333300014656GroundwaterMALSKENRKTIEFIEDKKKAMKKSQYREKFDALASEISTNLMDTAVSYGQKLYEKSGWGSLVTYNKMANGSYDINVYPQKLSGRDQNRSGVPVSQEPIAFSKIMIATSVLAGKLPDATVIADDKIYAKAMYELWKRNWAMTGANGSNTLMLTYQNLFTYGWAAWRVYPRRVQV
Ga0182027_1177025313300014839FenEKKKEMKKSQYREKFDTLAAEIDINLVNTTVTYGQKLYEKSGWGSMVFYNKMANGAYDINVYPQKLTDRDQNRSGVPVSQEPLAFAKIMVATSVLAGKLPDAEVVADDKIYAKAMYELWKRNWSMRGANGENTLMMTYQNLFTYGWAAWRVYPRRVQVPRKGTTKILFDDVYREPLDVHRTWLGIGFNHGDYWTWGEVY
Ga0194049_106034823300020157Anoxic Zone FreshwaterMANEKDMTPIETDGMTSPKSGKSDAYKFLTDKKREMKKSQYRERFDTLAAEIGINLMNTNVSYGQKLYEKSGWGSMVFYNKMANGAYDINVYPQKLTDRDQNRSGVPVSQEPIAFSKILIAASVLGGKLPDATVVADDKVYARASYELWKRSWSQTGGNGANTLGLTY
Ga0194043_114737413300021473Anoxic Zone FreshwaterMTPVETDNMTSQKSGKSDTVKFLLDKKKEMKKSQYRERFDTLAAEIGINLMNTNVSYGQKLYEKSGWGSMVFYNKMANGAYDINVYPQKLTDRDQNRSGVPVSQEPIAFSKILIAASVLGGKLPDSTVVADNKVYARANYELWKRSWTMQGGNGANTLGLTYQNLFTFGWAAWRVYPRRVQTQRKGVTKIMFDDIYREPMDVRRTWLGIGFNHGDCWSWGEAYYERDMQKEEFYRMYPEAKKNKKKLEYC
Ga0194043_123986113300021473Anoxic Zone FreshwaterFDTLAAEIGINLMNTNVSYGQKLYEKSGWGSMVFYNKMANGAYDINVYPQKLTDRDQNRSGVPVSQEPIAFSKILIAASVLGGKLPDATVIADDKVYAKASYELWKRSWSMTGGNGANTLGLTYQNLFTYGWAAWRIYPRRVQVKRNGVDKIMFDDVYREPLDVRRTWLGIGFNHGDCWSWGEVYYERDMQKEEFY
Ga0212124_1056845713300022553FreshwaterIEGKKKEMKKSQYREKFDTLAAEIKINLMNTTVSYGTKLYEKSGWGSLVFYNKMANGAYDINVYPQKLTDRDQNRSGVPVSQEPIAFSKIMIATSVLAGKLPDATVIADDKVYGKAMYELWKRNWAMTGGNGGNTLMITYQNLFTYGWAAWRVYPRRVQTKRNGVDKILFDDVYREPLDPTRTWLGIGFNNGDVW
Ga0222691_100596413300022851Saline WaterMAKKKATGDKKTIDFIADKKKEMKKSQYRIKFDALAAEIQTNIMNTSVSYGQKLYEKSGWGSMVFYNKMADGSYDINVYPQKLADRDQNRSGVPVSQEPIAFSKIMIATQVLAGKLPDAKVDADDKVYAKAMYELWKRNWKLTGANGENTLMLTYQNLFTYGWAAWRVYPRRVQVKRNGV
Ga0222657_106244413300023241Saline WaterKREMKKSQYRQKFDALAAEINQNLMATAVSYGNKLYEKSGWGSMVFYNKMASGAYDINVYPQKVTDRDKNNSGVPVSQEPIAFSKIMIATSVLAGKLPDGKVIADDKVYGKAMYELWKRNWSMTGGNGSNTLMLTYQNLFTYGWAAWRVYPRRVQVKRNGVDKILFDDIYREPLECTRTWMGVGFNNGDVWSQTEVYYEKDMPKE
Ga0222708_104185013300023242Saline WaterKSITESLLAIQFNMAKEQTKKDKATLLFIEEKKREMKKSQYREKFDILAAEIKQNIMSTAVSYGQKLYEKSGWGSMVFYNKMANGSYDINVYPQKITDRDQNKSGVPVSQEPIAFSKIMIATSVLAGKLPDATVIADDKVYGKAMYELWKRNWSMTGGNGANTLMLTYQNLFTYGWAAWRVYPRRVQVPRKGTTKILFDDIYREPLDNARTWLGVGFNN
Ga0222682_106448613300023246Saline WaterSKIYYMEDKKGKTEKDTINFIADKKKEMKKSQYRVKFDTLAFEIQQNLMNTGVSYGQKLYEKSGWGSMVFYNKMANGAYDINVYPQKLSDRDQNKSGVPVSQEPIAFSKIIIATSVLAGKLPDAQVVCDDKVYGKAMYELWKRNWSMTGGNGENTLMLTYQNLFTYGWAAWRVYPRRVQTKRNGVDKILFDDIYREPLEVTRTW
Ga0222703_100794913300023256Saline WaterMAKTETKEEKKTIDFIEGKKNEMKKSKYRVKFDALASEIDNNLINTMVSYGEKLYEQSGWGSMVFYNKMANGSYDINVYPQKATGAGKNNSGVPVSQEPIAFSKIIIATSVLAGKLPDAKVVADDKVYGKAMYELWKRNWSMTGANGSNTLMLTYQNIFTYGWAAWRVYPRRVQVPRNGTTKILFDDIYREPLECTRTWLGVGFNNGDAWSQTEVYYEKDMPKEEFFIMYPEADSGPNKKKLEYCSVSKEASDENTEKVQTSVTIGYYENVLTNRYVVTCGKMKIYDREL
Ga0222658_100671613300023257Saline WaterMENKKSDKATIEFIADKKKEMKKSQYRVKFDALASEIQQNLMNTAVSYGQKLYEKSGWGSMVFYNKMANGSYDINVYPQKLTDRDQNKSGVPVSQEPIAFSKIMIATQVLAGKLPDAQVACDNKVYGKAMYELWKRNWSMSGANGENTLMLTYQNLFTYGWAAWRVYPRRVQVPRNGVQKIL
Ga0222640_101018533300023297Saline WaterMEDKKGKTEKDTINFIADKKKEMKKSQYRVKFDTLASEIQQNLMNTGVSYGQKLYEKSGWGSMVFYNKMANGAYDINVYPQKLSDRDQNKSGVPVSQEPIAFSKIIIATSVLAGKLPDAQVVCDDKVYGKAMYELWKRNWSMTGGNGENTLMLTYQNLFTYGWAAWRVYPRRVQTKRNGVDKILFDDIYREPLEVTRTWLGIGFNNGDLWSQTEVYYEKDMPKEEFFDKYPGAK
Ga0222640_101776813300023297Saline WaterMSKTTLKGDKKTINFIEDKKKEMKKSQYREKFDALAAEINQNLMATAVSYGNKLYEKSGWGSMVFYNQMASGAYDINVYPQKITDRDQNNSGVPVSQEPIAFSKIMIATSVLAGKLPDGKVIADDKVYGKAMYELWKRNWSMTGGNGSNTLMLTYQNLFTYGWAAWRVYPRRVQVKRNGVDKILFDDIYREPLECTRTWLGVGFNNGDVWSQTEVYYEKDMPKEEFFEMYPDATTRANKKKLEYCSVSE
Ga0222640_102079623300023297Saline WaterMTKTTLKGDKKTINFIEEKKREMKKSQYRQKFDALANEIDQNLMATSVSYGNKLYEKSGWGSMVFYNKMASGAYDINVYPQKVTDRDKNNSGVPVSQEPIAFSKIMIATSVLAGKLPDGKVIADDKVYGKAMYELWKRNWSMTGANGSNTLMLTYQNLFTYGWAAWRVYPRRVQVKRNGVDKILFDDIYREPLECTRTWMGVGFNNGDVWSQTEVYYEKDMPKEEFFEMYPEGKKPSNKKKLEYCSVSDEAKDENSEKVHNSVTLGYYENVLMNRYVVVCG
Ga0222702_111546813300023299Saline WaterQKNIMNTSVSYGQKLYEKSGWGSMTFYNKMADGSYDINVYPQKLTDRDQNRSGVPVSQEPVAFSKIMIATSVLAGKLPDAIVIADDKVYGKAMYELWKRNWSMTGGNGANTLMLTYQNLFTYGWGAWRVYPRRVQVPRKGTTKILYDDIYREPLDVNRTWLGLGFNN
Ga0209414_104200613300023301HypersalineMYKNTDNSTGKKFTPGENKASYIFLTDKKKLMKESQYRKRFDGLFKEIEANIINTTVSYGQKVYEETGWGSMVFYNKMSNGAYDMNVYPQKINGQNDNKSGVPVSQEPIALSKILIATSVLAGKVPDCEVIGDDKIYNKAIHELWKRTWTLKGGNGQNTLERTYQNLFTYGWAAWRTYPRRVSVKRKGIDKILFDDIYREPMNPARTWFGIGQNVGDYWSQFEVYYEKDILK
Ga0209498_125298213300025135SedimentEKIYEKSGWGSMVFYNKLSNGAYDINVYPNKTSNVDKNKSGVPTSAEPIAFSKILIAASVLGGKLPDAQVIADDKVYARASYELWKRSWTMTGGNGANTLGLTYQNLFTYGWAAWRVYPRRVSVKRNGVDKIMFDDIYREPLNVKRTWLGIGFNHGDCWSWGEVYYERDMGEISNGDMVDLSAVFVNTIGSGSRLYLTANEIRKL
Ga0208901_102801513300025380Saline LakeSKTTLKGDKETIDFIEEKKREMKKSQYRQKFDALAAEINQNLMATAVSYGNKLYEKSGWGSMVFYNKMASGAYDINVYPQKVTDRDKNNSGVPVSQEPIAFSKIMIATSVLAGKLPDGKVIADDKVYGKAMYELWKRNWSMTGGNGSNTLMLTYQNLFTYGWAAWRVYPRRVQVKRNGVDKILFDDIYREPLECTRTWMGVGFNNGDVWSQTEVYYEKDMPKEEFFEMYPEAKSRTNKKKLEYCSVSDEAKDENSEKVQTSVTIGYYEN
Ga0208769_101896733300025697Saline LakeMEDKKGKTEKDTINFIADKKKEMKKSQYRVKFDTLASEIQQNLMNTGVSYGQKLYEKSGWGSMVFYNKMANGAYDINVYPQKLSDRDQNKSGVPVSQEPIAFSKIIIATSVLAGKLPDAQVVCDDKVYGKAMYELWKRNWSMTGGNGENTLMLTYQNLFTYGWAAWRVYPRRVQTKRNGVDKILFDDIYREPLEVTRTWLGIGFNNGDLW
Ga0207997_119948713300025736Saline LakeEDKKKEMKNSQYRTKFDLLSREVSQNLMNTTVGYGNKLYEKSGWGSMVMYNRMADGSYDINVYPNKLSGQDQNKSGVPSSQEPIAFSKIIIATSVLAGKLPDAQTIADDKVYARAMYELWKRNWSMTGANGENTLMLTYQNLFTYGWAAWRVYPRRVQVKRNGVDKILFDDIYREPLDCTRTWLGIGFNNGDVWSQSEVYY
Ga0208325_112877713300025824FreshwaterEMKKSQYREKFDTLAAEIKINLMNTTVSYGTKLYEKSGWGSLVFYNKMANGAYDINVYPQKLTDRDQNRSGVPVSQEPIAFSKIMIATSVLAGKLPDATVIADDKVYGKAMYELWKRNWAMTGGNGGNTLMITYQNLFTYGWAAWRVYPRRVQTKRNGVDKILFDDVYREPLDPTRTWLGIGFNNGDVW
Ga0209717_127856213300025855Anaerobic Digestor SludgeYGEKMYEKTGWGSMVFYNKMSNGAYDINVYPQKLQDRDQNRSGVPVSQEPIAFSKILIATSVLAGKVPDAETICDDKVYGKAAYELWKRTWTLKGGNGQNTLERTYQNLLTYGWAAWRTYPRRVSVPRNGITKILFDDVYREPMDPDRTWLGIGQNIGDYWSAFEVYYEKDILKDEFFEMVTLVQTRKLDRPVPIIAVG
Ga0209098_108404513300025867Anaerobic Digestor SludgeMAKLTTDDKKTIEFIENKKKEMKKSQYREKFDALAAEIEINLINTNVTYGQKLYEKSGWGSMVFYNKMANGAYDINVYPQKLTDRDQNRSGVPVSQEPIAFSKIMIATSVLAGKLPDATVIADDKVYAKAMYELWKRSWSMNGANGANTLMLVYQNMFTYGWAGWRVYPRRVSVKRNGVDKIIFDDIYREPLDPRRTWLGLGYNHGDFWSWGEVYYEKDMPKDEFYEKYPEAKKNKKLLDLCSVSEEAKDEN
(restricted) Ga0233415_1033701713300027861SeawaterMEIEKQSPLRGDKKTIEFIEDKKLEMKKSQYREKFDALASEIQQNIMNTTVSYGQKLYEKSGWGSMVFYNKMANGAYDINVYPQKLTDRDQNRSGVPVAQEPIAFAKIMIATSVLAGKLPDAKVVADDKVYAKAMYELWKRNWSMTGGNGGNTLMLTYQNLFTYGWAAWRVYPRRVQVKRNKVDKILFDDVYREPLEVTRTWLGVGFNNGDVWSQGEVYYEKDMQKEDFFNMYPDAKK
Ga0209777_1120083913300027896Freshwater Lake SedimentPVETVNMTSKKTDKSDTIKFITDKKKEMKKSQYRERFDTLAAEIGINLMNTNVSYGQKLYEKSGWGSMVFYNKMANGAYDINVYPQKLTDRDQNRSGVPVSQEPIAFSKILIAASVLGGKLPDATVVADDKVYAKAQYELWKRNWSMTGANGQNTLSLTYQNLFTYGWA
Ga0209668_1009620113300027899Freshwater Lake SedimentMTPVATDNMTTPKSGKADAYKFLTDKKKEMKKSQYRERFDTLAAEIGINLMNTNVSYGQKLYEKSGWGSMVFYNKMANGAYDINVYPQKLTDRDQNRSGVPVSQEPIAFAKILIAASVLGGKLPDATVVADDKVYARASYELWKRSWSMTGGNGANTLGLTYQNLFTYGWAAWRVYPRRVSVKRNGVEKIMFDDIYREPLDVRRTWLGIGFNHGDCWSWGEVYYERDMPKEDFYRMYPEAKKNKKKLEYCSVSEEAKDENSEKAHTSVTIGYYENYLANRYIVQCGKMYR
Ga0268279_115685713300028169Saline WaterMENEKKPKDKKNTIDFITQKKDKMIKSQYRVKFDALFKEVENNLMNTNVSYGQKLYEKTGWGSMVFYNKQADGSYDYNVYPQKLTGQDQNNSGVPVSQEPIAFSKILIATSVLAGKLPDATVIADDKVYGKAMYELWKRNWSMAGGNGANTLMLTYQNLFTYGWA
Ga0265322_1007017713300028654RhizosphereMAKAKTPDEKTIEFLTKKKDEMKKSQYREKFDALASEVEINILNTSVSYGQKLYEKSGWGSMVFYNKMANGAYDINVYPQKLTDRDQNRSGVPVSQEPIAFSKIMIATSVLAGKLPDATVVADDKVYARAAYDLWKRGWSMKGANGANTLMTTYQNIFTYGWAAWRIYPRRVQVDRGNIKKILFDDIYREPLDPKRTWLGVGFNLGDYWSQFEVYYEKDMPKEEFFDKYPAAEKNKNKKVYLQYCTVSKEATDENSEKVFTHVTIGYYENVLLNRYIVACGKMKIYDGEMPNDDSFGSVV
Ga0302204_105865413300028763FenMDNPKLKGDKSTIDFIENKKNEMKKSQYRERFDTLISEIKQNLMNTNVSYGQKLYEKSGWGSMVFYNKMANGAYDINVYPQKLTDRDQNRSGVPVSQEPIAFSKIMIATSVLAGKLPDATVIADDKVYGKAMYELWKRNWSMTGANGSNTLMITYQNLFTYGWAAWRVYPRRVQTKRNGVDKILFDDIYREPLDPERTWLGIGFNNGDVWSQTEVYYEKDMQKDLFYEMYPESKKNKKK
Ga0302213_109608113300028769FenMDNPKLKGDKSTIDFIENKKNEMKKSQYRERFDTLISEIKQNLMNTNVSYGQKLYEKSGWGSMVFYNKMANGAYDINVYPQKLTDRDQNRSGVPVSQEPIAFSKIMIATSVLAGKLPDATVIADDKVYGKAMYELWKRNWSMTGANGSNTLMITYQNLFTYGWAAWRVYPRRVQTKRNGVDKILFDDIYREPLDPERTWLGIGFNNGDVWSQTEVYYEKDMQKDLFYEMYPESKKNKKKLDYCSVTKEATDENSEKAHTSVTIGYYENVL
(restricted) Ga0247841_1006002813300029286FreshwaterMEYEKDMTSVTTEGMTSKKGGEKATYEFLVNKKKEVKKSQYREKFDGLVQEIEQNLVNTNVSYGQKIYEKSGWGSMVFYNKMANGAYDINVYPQKALDRDQNRSGVPVAAEPIAFSKILIAASVLGGKLPDAQVIADDKVYAKSSYELWKRSWSMTGGNGANTLGLTYQNLFTYGWAAWRVYPRRVSVKRNGVDKILFDDIYREPLNVRRTWLGIGFNHGDCWSWGEVLYEKDMPKEDFFRMYPEAKLSKNRKKLEYCTVSDEAKDEN
(restricted) Ga0247841_1041393813300029286FreshwaterMDKNLKDMTPDNSGNFNNKKGGNKKDKATIDFIEEKKKLMKKSQYREKFDALASEIATNLMNTNVSYGQKLYEKSGWGSMVFYNKMANGAYDINVYPQKLTDRDQNRSGVPVSQEPIAFSKIMIATSVLAGKLPDATVVADDKIYAKAMYELWKRNWSMTGANGSNTLMLTYQNLFTYGWAAWRVYPRRVQVKRNGVDKILFDDVYREPLDCTRTWLGLGFTNGDYWSQFETYYEKDMVKDEFYAMYPEAEKNKKKLEYCSVSEEAKNENYEK
(restricted) Ga0247841_1064120913300029286FreshwaterNTGVSYGQKLYEKSGWGSMVFYNKMANGAYDINVYPQKLSDRDQNRSGVPVSQEPLAFSKIMIATSVLAGKLPDAKVIADDKIYAKASYELWKRSWSMAGGNGANTLMLTYQNLFTYGWAAWRVYPRRVQVPRKGTVKILFDDIYRESLDCARTWLGVGFNHGDYWSWGEVYYERDIPKDDFYAMYPEAKKNKKKLQYCSASEEAKDENPDKVQTH
(restricted) Ga0247841_1088020413300029286FreshwaterYGQKLYEKSGWGSMVFYNKMANGAYDINVYPQKLTDRDQNRSGVPVSQEPIAFSKILIATSVLAGKLPDAEVIADDKIYARAVYELWKRSWSLTGGNGANTLMLTYQNLFTYGWAAWRVYPRRVQVPKNGVDKILFDDIYREPLDPKRTWLGIGFNHGDYWSWGEVYYEKDMP
Ga0302207_111456813300030230FenKKNEMKKSQYRERFDTLISEIKQNLMNTNVSYGQKLYEKSGWGSMVFYNKMANGAYDINVYPQKLTDRDQNRSGVPVSQEPIAFSKIMIATSVLAGKLPDATVIADDKVYGKAMYELWKRNWSMTGANGSNTLMITYQNLFTYGWAAWRVYPRRVQTKRNGVDKILFDDIYREPLDPERTWLGIGFNNGDVWSQTEVYYEKDMQKDLFYEMYPESKKNKKKLDYCSVTKEATD
Ga0311366_1092024213300030943FenMVTTKSKSDKEVIEFIENKKKEMKKSQYREKFDTLASEIATNLMNTGVSYGQKLYEKSGWGSMVFYNKMANGAYDINVYPQKLTDRDQNRSGVPVSQEPIAFSKIMIATSVLAGKLPDATVISDDKVYGKAMYELWKRNWSMTGANGGNTLMITYQNLFTYGWAAWRVYPRRVQTKRNGVDKILFDDVYREPLDPTRTWLGV
Ga0307928_1005146223300031227Saline WaterMEVEKKLALKNDKATIKFVEDKKIEMKKSQYRVKFDALASEIQQNIMNTSVSYGTKLYEKSGWGSMVFYNKMANGAYDINVYPQKLTDRDQNRSGVPASQEPIAFSKIMIATSVLAGKLPDAKVIADDKVYGKAMYELWKRNWSMTGANGENTLMLTYQNLFTYGWAAWRVYPRRVQVKRNGVDKILFDDIYREPLECTRTWLGVGFNNGDVWSQTEVYYEKDMPKEDFFQM
Ga0307380_1040429713300031539SoilMAKKPTGDKATIEFINEKKDQMKKSQYRIRFDALASEIDKNLLDTSVSYGQKLYEKSGWGSMVFYNKMANGAYDINVYPNKLASRDQNKSGVPVAQEPIAFSKIIIATSVLAGKLPDAKVVADDKVYAKTAYELWKRSWSMTGANGENTLMLTYQNLFTYGWAAW
Ga0307380_1067557213300031539SoilMADNMTSVDIDNMTTPKGDKKDAFKFIEDKKKEMKKSQYRERFDALANEIDQNLMNTSVSYGEKLYEKSGWGSMVFYNKMANGAYDINVYPNKSADRDKNRSGVPTSQEPIAFAKIMIAASVLGGKLPDAQVVADDKVYARASYELWKRSWSQTGGNGANTLGLTYQNLFTYGWAAWRVYPRRVSVKRNGVDKIMFDDIYRE
Ga0307380_1106892113300031539SoilMAKISKEEKKTIDFISDKKKEMKKSQYREKFDALYSEIDTNLMNTGVSYGQKLYEKSGWGSMVFYNKMANGAYDINVYPQKLTDRDQNRSGVPVSQEPIAFSKIMIATSVLAGKLPDATVIADDKIYGKAMYELWKRNWSMIGANGQNTLLLTYQNLFTYGWGAWRVYPRRVQVKRRGVDKILFDDVYREPLNPSRTW
Ga0307380_1135874413300031539SoilKSKPTDVETVKFIENKKKEMKKSQYREKFDALAAEIQQNIMSTAVSYGQKLYEKSGWGSMVFYNKMANGAYDINVYPQKLTDRDQNHSGVPVSAEPIAFSKIMIATSVLAGKLPDATVVADDKVYAKACYELWKRNWSMTGANGSNTLMLTYQNLFTYEWAAWRVYPRRVQVKRNGVDK
Ga0307379_1058585923300031565SoilMAKKPTGDKATIEFINEKKDQMKKSQYRIRFDALASEIDKNLLDTSVSYGQKLYEKSGWGSMVFYNKMANGAYDINVYPNKLASRDQNKSGVPVAQEPIAFSKIIIATSVLAGKLPDAKVVADDKVYAKTAYELWKRSWSMTGANGENTLMLTYQNLFTYGWAAWRVYPRRVQVPRKGTIKILFDDIYREPLECTRTWLGIGFNNGDVWSQTEVYYERDMPKEEFFLMYPDAKKNKKKLQYISVSKESSDEDPDKVQNSVTIGYYENVLTNRYIV
Ga0307379_1128208513300031565SoilDMTPVQTDNMTTPKGEKKDAFKFIEDKKKEMKKSQYRERFDALASEIDANLMNTAVSYGEKLYEKSGWGSMVFYNKLANGAYDINVYPQKALDRDKNRSSVPISQEPIAFAKILIAASVLGGKLPDSTVIADDKVYARASYELWKRSWSMTGGNGANTLGLTYQNLFTYGWGAWRVYPRRVSVKRNGVEKIMFDDIYREP
Ga0307379_1141773113300031565SoilKLYEKSGWGSMVFYNKMANGAYDINVYPNKSTDRDKNRSGVPTSQEPIAFAKIMIAASVLGGKLPDAQVVADDKVYARASYELWKRSWSQTGGNGANTLGLTYQNLFTYGWAAWRVYPRRVSVKRNGVDKIMFDDIYREPLDCKRTWMGIGFNHGDCWSWGEVYYERDMPKEDFFRMYPEAKSKK
Ga0307378_1040439313300031566SoilMETVKKISSKEEKEIISFIEEKKKEMKKSQYRIKFDALYQEIQQNLMNTTVSYGQKLYEKSGWGSMVFYNKMASGAYDINVYPQKIANLDQNKTGVPVSQEPIAFSKIIIATSVLAGKLPDAKVIVDDKVYGKAMYELWKRNWSMTGANGSNTLMITYQNLFTYGWAAWRVYPRRVQTKRKGVDKILFDDIYREPLDCNRTWLGIGFNNGDYWSQTEVYYEKDITKDDFFRMYPDAKKNKKKLQYVAVTEEAKDENSEKNQT
Ga0307376_1007193913300031578SoilMDEAKKVKRKTDKDIVEFIDDKKKEMKKSQYRERFDAIAAEVNQNIMNTNVSYGQKLYEKSGWGSMVFYNKMANGSYDINVYPQKLTDRDQNRSGVPVSQEPIAFSKIMIATSVLAGKLPDAKVIADNKVYAKAMYELWKRNWSMTGGNGGNTLMLTYQNLFTYGWAAWRVYPRRVQTKRNGVDKILFDDVYREPLDCT
Ga0307376_1011608123300031578SoilMELEKKTPLKGDKATIAFIDEKKKEMKKSQYREKFDALASEIQQNIINTNVSFGQKLYEKSGWGSMVFYNKMANGAYDINVYPQKLTDRDQNRSGVPVSQEPIAFSKIMIATSVLAGKLPDATVVADDKVYGKAMYELWKRNWAMTGGNGANTLMLTYQNLFTYGWAAWRVYPRRVQVKRNGVEKILFDDVYREPLDCTRTWLGVGFNNGDVWSQTEVYYEKDMPKQDFFDKYPEAKKNKKKLQYCSVSEEAKDENSEKAHTSVTIGYYENVLTNRYIVVC
Ga0307376_1023862733300031578SoilMAKKLKGDKATIDFIEEKKKEMKKSQYRVRFDALAQEIQSNIMNTTVSYGQKLYEKSGWGSMVFYNKMADGSYDINVYPQKLADRDQNRSGVPVSAEPIAFSKIIIATSVLAGKLPDAQVVADDKVYGKAMYELWKRSWSMTGANGENTLMLTYQNLFTFGWAAWRVYPRRVQTKRNGVYKILFDDIYREPLDVTRTWLGIGFNNGDVW
Ga0307376_1047509613300031578SoilQNLMNTTVSYGTKLYEKSGWGSMVFYNKMANGSYDINVYPQKVSDRDQNKSGVPVSQEPIGFAKIMIATSLLAGKLPDAKVVADNKVYAKAMYELWKRNWSMTGGNGANTLMITYQNLFTYGWSAWRVYPRRVQTKRNGVDKILFDDVYREPLEPTRTWLGLGFNNGDVWSQTEVYYEKDTPKDDFFRMYPEAKKNKKKLQYVSVSEEAKDENTDKALTHVTIGYYENVLANRYAVICGKMVIYDGELPNDGSHGSVVVARCFQKNMNDP
Ga0307992_124704213300031601MarineNMATKKTEKATIEFITNKKKEMKKSKYRVKFDSLVKEIEQNLLNTSVSYGQKLYEKSGWGSMVFYNKTSDGSYDINVYPQKTGDRDQNKSGVPVSQEPIAFSKIMIATQVLAGKLPDAQVVCDDKVYGKAMYELWKRNWSMTGANGANTLMLTYQNLFTYGWASWRVYPRRVQVKRNNVDKILFDDIYREPMDCSRTWLGVGFNNGDVWSQTE
Ga0307992_125680413300031601MarineMSKTTLKGDKKTINFIEEKKREMKKSQYREKFDTLAAEINQNLMATAVSYENKLYEKSGWGSMVFYNKMASGAYDINVYPQKTTGNDKNNSGVPVSQEPIAFSKIMIATSVLAGKLPDGKVISDDKVYGKAMYELWKRNWSMTGANGSNTLMINYQNLFTYGWAAWRVYPRRVQVKRNGVDKILFDDI
Ga0307992_130330913300031601MarineRVKFDALAKEIEQNLMNTNVSYGQKLYEKSGWGSMMFYNKMADGSYDINVYPNKLTSQDQNKSGVPVSQEPIAFSKIMIATQVLAGKLPDAKVVADNKVYAKAMYELWKRNWSMTGANGENTLMLTYQNLFTYGWGAWRVYPRRVQVPRNGSTKILFDDVYREPLECTRTWLGVGFNNGDVWSQ
Ga0307992_130569913300031601MarineMVFYNKMASGAYDINVYPQKVTDRDQNNSGVPVSQEPIAFSKIMIATSVLAGKLPDGKVIADDKVYGKAMYELWKRNWSMTGANGSNTLMLTYQNLFTYGWAAWRVYPRRVQVKRNGVDKILFDDIYREPLECTRTWMGVGFNNGDVWSQTEVYYEKDMPKEEFFEMYPDADTRANK
Ga0307377_1048391713300031673SoilMENKKPKGDKGIIQFIDDKKIEMKKSQYRVKFDALASEIHTNIMNTGVSYGQKLYEKSGWGSMVFYNKMANGSYDINVYPQKLSDRDQNRSGVPVSQEPIAFSKIMIATSVLAGKLPDATVIADDKVYGKAMYELWKRNWAMTGSNGGNTLMLTYQNLFTYGWAAWRVYPRRVQVKRNGVAKILFDDIYREPLDCTRTWLGIGFNNGDVWSQSEVYYEKDVPKEEFYEMYPEAKKNK
Ga0315288_1174194813300031772SedimentNGAYDINVYPQKLTDRDQNRSGVPVSQEPIAFSKIMIATSVLAGKLPDATVVADDKIYAKAMYELWKRNWSMTGANGGNTLMLTYQNLFTYGWAAWRVYPRRVQVKRNGVDKILFDDVYREPLDCRRTWLGLGFTNGDYWSQMEVYYEKDMLKDEFYDKYPEAKKN
Ga0311367_1160965713300031918FenTLISEIKQNLMNTNVSYGQKLYEKSGWGSMVFYNKMANGAYDINVYPQKLTDRDQNRSGVPVSQEPIAFSKIMIATSVLAGKLPDATVIADDKVYGKAMYELWKRNWSMTGANGSNTLMITYQNLFTYGWAAWRVYPRRVQTKRNGVDKILFDDIYREPLDPERTWLGIGFNNGDVWSQTEVYYEKDMQKDLFYEMYPESKKNKKKLDYCS
Ga0315294_1045297313300031952SedimentMAEDMTPVETDNMTTPKSAKSDTYKFIEEKKKEMKKSQYRERFDTLAAEIGINLMNTNVSYGQKLYEKSGWGSMVFYNKMANGAYDINVYPQKLTDRDQNRSGVPVSQEPIAFSKIMIATSVLAGKLPDATVIADDKVYAKACYELWKRNWSMNGANGANTLMLV
Ga0315294_1134895513300031952SedimentKAVIEFILEKKKEMKKSQFRERFDTLAAKIGQNIMNTNVSYGQKLYEKSGWGSMVFYNKMANGAYDINVYPQKLTDRDQNRSGVPVSQEPIAFSKIMIATSVLAGKLPDAEVIADNKVYAKAMYELWKRNWAMTGGNGSNTLMLTYQNLFTYGWAAWRVYPRRVQVPRKGTIKILFDDIYREPLDVTRT
Ga0315274_1208466213300031999SedimentEKFDALASEIETNIINTNVSYGQKLYEKSGWGSMVFYNKMANGAYDINVYPQKLTDRDQNRSGVPVSQEPIAFSKIMIATSVLAGKLPDATVVADDKIYAKAMYELWKRNWSMTGANGGNTLMLTYQNLFTYGWAAWRVYPRRVQVKRNGVDKILFDDVYREPLDCRR
Ga0315289_1009646063300032046SedimentMITKTDKKTIEFIEDKKKAMKKSQYREKFDALASEIETNIINTNVSYGQKLYEKSGWGSMVFYNKMANGAYDINVYPQKLTDRDQNRSGVPVSQEPIAFSKIMIATSVLAGKLPDATVVADDKIYAKAMYELWKRNWSMTGANGGNTLMLTYQNLFTYGWAAWRVYPRRVQVKRNGVDKILFDDVYREPLDCRRTWLGLGFTNGDYWSQMEVYYEKDMLKDEFYDKYPEAKKNKRNLSLLLIPKKKQQIQMSELRKKLKMRIGRS
Ga0315289_1139978413300032046SedimentYIASKKKEMKKSQYREKFDTLRAEIATNLVNTTVSYGQKLYEKSGWGSMVFYNKMTNGAYDINVYPQKLTDRDQNRSGVPVSQEPIAFSKILIATSVLAGKLPDAQVIADDKIYGKAAYELWKRSWSMTGANGSNTLLLTYQNLFTYGWAAWRVYPRRVQVKRKGVDKILFDDIYREPMD
Ga0315284_1028602613300032053SedimentMEYSDTGEGGMTPPGSTQGMTPTPATSKPDRKTIDFVAEKKKMMKKSQYREKFDALASEIEINLVNTNVTYGQKLYEKSGWGSMVFYNKMANGAYDINVYPQKLTDRDQNRSGVPVSQEPIAFSKIMIATSVLAGKLPDATVVADDKIYGKAMYELWKRNWSMTGGNGENTLMLTYQNLFTYGWAAWRVYPRRVQVKRQGVDKILFDDIYREPLDVKRTWLGL
Ga0315284_1157042213300032053SedimentIMDRKKEMKKSQYRERFDNLAAEIQQNLVNTSVSYGQKLYEKSGWGSVVFYNKMANGAYDINVYPQKLTDRDQNRSGVPVSQEPIGFSKILIAASVLGGKLPDATVVADDKVYAKASYELWKRSWSMTGGNGANTLGLTYQNLFTYGWAAWRVYPRRVQTKRNGVTKIMFDDVYREPMDVRRTWLGIGFNHGDCWSWGEAYYERDMQKEEFYRMYPEAKQNKKKLQYCSVS
Ga0315284_1195961213300032053SedimentMTPTPASSKPDRKTIDFVAEKKKMMKKSQYREKFDALASEIEINLVNTNVTYGQKLYEKSGWGSMVFYNKMANGAYDINVYPQKLTDRDQNRSGVPVSQEPIAFSKIMIATSVLAGKLPDATVIADDKIYGKAMYELWKRNWSMTGVNGENTLMLTYQNLFTYGWAAWRVYPRR
Ga0315277_1184487413300032118SedimentFISEKKKEMKKSQYREKFDALASEIEINIMNTNVTYGQKLYEKSGWGSMVFYNKMANGAYDINVYPQKLTDRDQNRSGVPVSQEPIAFAKILIATSVLAGKLPDATVIADDKIYGKAMYELWKRNWSMTGANGANTLMLTYQNLFTYGWAAWRVYPRRVQVKRNGV
Ga0315276_1187288713300032177SedimentKDMTPVETDNMTTPKSGKKDTVKFIQDKKKEMKKSQYRERFDTLASEIGINLLNTNVSYGQKLYEKSGWGSMVFYNKMANGAYDINVYPQKLTDRDQNRSGVPVSQEPIAFAKIMIATSVLAGKLPDATVIADDKVYAKAMYELWKRNWSMNGANGENTLMLTYQNLFTYGWAAWRVYPRRVQVKRNGVDKIMFDDVYREPLEV
Ga0315273_1047914623300032516SedimentMITKTNKKTIEFIEEKKKAMKKSQYREKFDALASEIETNIINTNVSYGQKLYEKSGWGSMVFYNKMANGAYDINVYPQKLTDRDQNRSGVPVSQEPIAFSKIMIATSVLAGKLPDATVVADDKIYAKAMYELWKRNWSMTGGNGANTLMLTYQNLFTYGWAAWRVYPRRV
Ga0315273_1174120813300032516SedimentNLMNTNVSYGQKLYEKSGWGSMVFYNKMANGAYDINVYPQKLTDRDQNRSGVPVSQEPIAFSKIMIATSVLAGKLPDATVIADDKVYAKAMYELWKRNWSMHSANGSNTLMLTYQNLFTYGWAAWRVYPRRVQVKRNGVAKILFDDVYREPLDCTRTWLGIGFNNGDIWSQMEVYYEKDMPKEDFYNMYPEAKKNKKKLEYCSVTDEAKDENSEKAHTSVTIGYYENVLMNRYVVVCGKMVIYDGELPND
Ga0334722_1024775733300033233SedimentMPDDLPTNEYSQPTTAPPLKKADRETYEYVEEKKKMMKKSQYREKFDALAAEIEINIMNTNVTYGQKLYEKSGWGSMVFYNKMANGAYDINVYPQKLTDRDQNRSGVPVSQEPIAFSKIMIATSVLAGKLPDATVIADDKIYAKASYELWKRSWSMTGGNGENTLMLTYQNLFTYGWAAWRVYPRRVQVKRNGVDKILFDDVYREPLDNKRTWLGLGFTNGDYWSQFEVYYEKDMLKDEFYEKYPEAKKNKKKLEYCSVSEEAKDENSEKLRTSVTIGYYENILLNRYIVKCGKM
Ga0370495_0007750_2_7693300034257Untreated Peat SoilMDEDQNSTNSKPVNDDGTTGTKTEDADKATVKFLVEKKKNIKKSQYRERFDALAAEIDLNIINTTISYGQKIYEKSGWGSMVFYNKMANGAYDINVYPQKLTDRDQNRSGVPVSQEPIALSKILIATSVLFGKQPDAEVIADDKIFAKAIHELWKRTWYLKGGNGQNTLSLSSQNLFTYGWAAWRVYPKRVSVKRKGVDKLLFDDVYREPMDPKRTWLGLGFTNGDYWSQFEVLYEKDMLKTEFFDKYPMAKDNKR

 ⦗Top⦘


Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.