Scaffold M940CN_1000151

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold M940CN_1000151

Scaffold M940CN_1000151

Overview

Basic Information
Taxon OID	3300000504 Open in IMG/M
Scaffold ID	M940CN_1000151 Open in IMG/M
Source Dataset Name	Microbial Communities from Little Sippewissett Salt Marsh, Woods Hole, MA that are anoxygenic and photosynthetic, Marine photosynthetic community that grows at 940nm
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Marine Biological Laboratory
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	4456
Total Scaffold Genes	9 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	6 (66.67%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae → Anaerolinea → Anaerolinea thermophila	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh → Salt Marsh Microbial Communities From Little Sippewissett, Woods Hole, Ma That Are Anoxygenic And Photosynthetic

Source Dataset Sampling Location
Location Name	Little Sippewissett Salt Marsh, Woods Hole, MA
Coordinates	Lat. (^o)	41.5758508	Long. (^o)	-70.635807	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F088355	Metagenome / Metatranscriptome	109	Y

Sequences

Protein ID	Family	RBS	Sequence
M940CN_10001518	F088355	AGGAG	MKNLSNKISVFAGKKGQLILAILTIALFVLAAGAPNATLGIGR*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.