Basic Information | |
---|---|
Taxon OID | 3300000504 Open in IMG/M |
Scaffold ID | M940CN_1000151 Open in IMG/M |
Source Dataset Name | Microbial Communities from Little Sippewissett Salt Marsh, Woods Hole, MA that are anoxygenic and photosynthetic, Marine photosynthetic community that grows at 940nm |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Marine Biological Laboratory |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 4456 |
Total Scaffold Genes | 9 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 6 (66.67%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae → Anaerolinea → Anaerolinea thermophila | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Marine → Intertidal Zone → Salt Marsh → Salt Marsh → Salt Marsh Microbial Communities From Little Sippewissett, Woods Hole, Ma That Are Anoxygenic And Photosynthetic |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Little Sippewissett Salt Marsh, Woods Hole, MA | |||||||
Coordinates | Lat. (o) | 41.5758508 | Long. (o) | -70.635807 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F088355 | Metagenome / Metatranscriptome | 109 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
M940CN_10001518 | F088355 | AGGAG | MKNLSNKISVFAGKKGQLILAILTIALFVLAAGAPNATLGIGR* |
⦗Top⦘ |