Scaffold JGI20241J16302_100670

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold JGI20241J16302_100670

Scaffold JGI20241J16302_100670

Overview

Basic Information
Taxon OID	3300001633 Open in IMG/M
Scaffold ID	JGI20241J16302_100670 Open in IMG/M
Source Dataset Name	Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF007
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	846
Total Scaffold Genes	4 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (25.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil → Forest Soil Microbial Communities From Harvard Forest Long Term Ecological Research (Lter) Site In Petersham, Ma, For Long-Term Soil Warming Studies

Source Dataset Sampling Location
Location Name	Harvard Forest LTER, Petersham, MA, USA
Coordinates	Lat. (^o)	42.532967	Long. (^o)	-72.209488	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F007832	Metagenome / Metatranscriptome	344	Y

Sequences

Protein ID	Family	RBS	Sequence
JGI20241J16302_1006702	F007832	N/A	VLFLADIFPGGGSPIADVFSIAIAIAMFALLYWLISLIDRI*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.