Scaffold Ga0065719_141453

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0065719_141453

Scaffold Ga0065719_141453

Overview

Basic Information
Taxon OID	3300005275 Open in IMG/M
Scaffold ID	Ga0065719_141453 Open in IMG/M
Source Dataset Name	Hot spring sediment microbial communities from Great Boiling Spring, Nevada - Cellulolytic enrichment CS 85C
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	DOE Joint Genome Institute (JGI)
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	504
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
Not Available	(Source: )

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Aquatic → Thermal Springs → Hot (42-90C) → Sediment → Hot Spring → Hot Spring Microbial Communities From Great Boiling Spring, Nevada

Source Dataset Sampling Location
Location Name	Great Boiling Spring, Nevada
Coordinates	Lat. (^o)	40.67	Long. (^o)	-119.37	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F088087	Metagenome	109	N

Sequences

Protein ID	Family	RBS	Sequence
Ga0065719_1414532	F088087	AGGTGG	VIKASDSSVWRSVGVSSSSCEICRKKGRAQIYECVEGKWAGVRVVACPEHAQKAVEVFIAGGEE*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.