Basic Information | |
---|---|
Taxon OID | 3300005794 Open in IMG/M |
Scaffold ID | Ga0079490_100087 Open in IMG/M |
Source Dataset Name | Subglacial sediment microbial community from Lake Whillans, Antarctica - at 0-2 cm depth |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | The Marine Biological Laboratory |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 4282 |
Total Scaffold Genes | 6 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 4 (66.67%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Environmental → Aquatic → Freshwater → Sediment → Unclassified → Sediment → Subglacial Freshwater Microbial Communities From Lake Whillans, Antarctica |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | West Antarctica | |||||||
Coordinates | Lat. (o) | -84.24 | Long. (o) | -153.694 | Alt. (m) | Depth (m) | 0 to .02 | Location on Map |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F025775 | Metagenome | 200 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0079490_1000873 | F025775 | AGGAG | MKQFMSFQNFPMVVVTLMIIWAWISILSVLIASFF* |
⦗Top⦘ |