Basic Information | |
---|---|
Taxon OID | 3300006967 Open in IMG/M |
Scaffold ID | Ga0102599_111308 Open in IMG/M |
Source Dataset Name | T0 (1) T34 (live) enrichments of Methanogenic microbial communities using Athabascan oil sands |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Shell Corporation |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 508 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (50.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Environmental → Terrestrial → Oil Reservoir → Unclassified → Unclassified → Oil Sands → Methanogenic Incubations Using Athabaskan Oil Sands From Alberta Canada |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Canada: Alberta | |||||||
Coordinates | Lat. (o) | 57.02 | Long. (o) | -111.65 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F088355 | Metagenome / Metatranscriptome | 109 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0102599_1113081 | F088355 | N/A | LNKSLSTLGEKIMKNIKNKISVFAGQKGQLVLAILTIALFVLAAGAPNATIGVGR* |
⦗Top⦘ |