Scaffold Ga0102599_111308

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0102599_111308

Scaffold Ga0102599_111308

Overview

Basic Information
Taxon OID	3300006967 Open in IMG/M
Scaffold ID	Ga0102599_111308 Open in IMG/M
Source Dataset Name	T0 (1) T34 (live) enrichments of Methanogenic microbial communities using Athabascan oil sands
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Shell Corporation
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	508
Total Scaffold Genes	2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	1 (50.00%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	0 (0.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Chloroflexi → Anaerolineae → Anaerolineales → Anaerolineaceae	(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Oil Reservoir → Unclassified → Unclassified → Oil Sands → Methanogenic Incubations Using Athabaskan Oil Sands From Alberta Canada

Source Dataset Sampling Location
Location Name	Canada: Alberta
Coordinates	Lat. (^o)	57.02	Long. (^o)	-111.65	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F088355	Metagenome / Metatranscriptome	109	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0102599_1113081	F088355	N/A	LNKSLSTLGEKIMKNIKNKISVFAGQKGQLVLAILTIALFVLAAGAPNATIGVGR*

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.