Basic Information | |
---|---|
Taxon OID | 3300009473 Open in IMG/M |
Scaffold ID | Ga0127520_1011186 Open in IMG/M |
Source Dataset Name | Microbial communities of aphids from lettuce in Tucson, AZ, USA - Acyrthosiphon lactucae NM052899 seqcov |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | University of Texas, Austin |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 2078 |
Total Scaffold Genes | 1 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 1 (100.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Eukaryota → Opisthokonta → Metazoa → Eumetazoa → Bilateria → Protostomia → Ecdysozoa → Panarthropoda → Arthropoda → Mandibulata → Pancrustacea → Hexapoda → Insecta → Dicondylia → Pterygota → Neoptera → Paraneoptera → Hemiptera → Sternorrhyncha → Aphidomorpha → Aphidoidea → Aphididae → Aphidinae → Aphidini → Aphis → Aphis | (Source: UniRef50) |
Source Dataset Ecosystem |
---|
Host-Associated → Insecta → Unclassified → Unclassified → Unclassified → Lettuce → Host-Associated Microbial Communities Of Aphids From Plants In Several Locations Around Usa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | Tucson, AZ, USA | |||||||
Coordinates | Lat. (o) | 32.23184 | Long. (o) | -110.950699 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F029983 | Metagenome | 186 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0127520_10111861 | F029983 | GGTGG | MSLCCTVGYKWVTVMDGVRFEFNDIISSYTKNDSERRRLVS |
⦗Top⦘ |