NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0119927_110157

Scaffold Ga0119927_110157


Overview

Basic Information
Taxon OID3300013282 Open in IMG/M
Scaffold IDGa0119927_110157 Open in IMG/M
Source Dataset NameActivated sludge bacterial and viral communities from EBPR bioreactors in Queensland, Australia - SBR4-V92809
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterCalifornia Institute of Technology
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)733
Total Scaffold Genes2 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Novel Protein Genes1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)0 (0.00%)
Associated Families1

Taxonomy
All Organisms → cellular organisms → Eukaryota → Sar → Alveolata → Ciliophora → Intramacronucleata → Spirotrichea(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Engineered → Wastewater → Nutrient Removal → Biological Phosphorus Removal → Bioreactor → Activated Sludge → Activated Sludge Bacterial And Viral Communities From Ebpr Bioreactors In Australia

Source Dataset Sampling Location
Location NameAustralia: Queensland
CoordinatesLat. (o)-27.49999Long. (o)153.01209Alt. (m)Depth (m)
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F095570Metagenome / Metatranscriptome105Y

Sequences

Protein IDFamilyRBSSequence
Ga0119927_1101571F095570N/APQNPKTPFQFNIIIMTEYLYDRDNPKSALRQRITGIEGFFYGLPNINERAEMVNRALLKENDNDITKFANQLKKPRDNA*

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.