Basic Information | |
---|---|
Taxon OID | 3300014814 Open in IMG/M |
Scaffold ID | Ga0119849_1014733 Open in IMG/M |
Source Dataset Name | Wastewater bioreactor microbial communities from Cape Town, South Africa - Thiocyanate-only bioreactor |
Source Dataset Category | Metagenome |
Source Dataset Use Policy | Open |
Sequencing Center | Banfield Lab, University of California, Berkeley |
Sequencing Status | Permanent Draft |
Scaffold Components | |
---|---|
Scaffold Length (bps) | 1828 |
Total Scaffold Genes | 2 (view) |
Total Scaffold Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Novel Protein Genes | 1 (view) |
Novel Protein Genes with Ribosome Binding Sites (RBS) | 0 (0.00%) |
Associated Families | 1 |
Taxonomy | |
---|---|
All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria | (Source: IMG/M) |
Source Dataset Ecosystem |
---|
Engineered → Bioreactor → Unclassified → Unclassified → Unclassified → Wastewater Bioreactor → Wastewater Bioreactor Microbial Communities From Cape Town, South Africa |
Source Dataset Sampling Location | ||||||||
---|---|---|---|---|---|---|---|---|
Location Name | South Africa: University of Cape Town, Rondebosch | |||||||
Coordinates | Lat. (o) | -33.96 | Long. (o) | 18.46 | Alt. (m) | Depth (m) | Location on Map | |
Zoom: | Powered by OpenStreetMap © |
Family | Category | Number of Sequences | 3D Structure? |
---|---|---|---|
F025775 | Metagenome | 200 | Y |
Protein ID | Family | RBS | Sequence |
---|---|---|---|
Ga0119849_10147331 | F025775 | N/A | ARTMKQLLTFQGFPMVVVTALIVWAWISIFSVLIASFF* |
⦗Top⦘ |