Scaffold Ga0246235_101953

NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters

x

This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK

Scaffold Ga0246235_101953

Scaffold Ga0246235_101953

Overview

Basic Information
Taxon OID	3300029892 Open in IMG/M
Scaffold ID	Ga0246235_101953 Open in IMG/M
Source Dataset Name	Fracture fluid microbial communities from borehole on the 26 level of Beatrix Gold Mine, Welkom, South Africa - Be326_2011_MF
Source Dataset Category	Metagenome
Source Dataset Use Policy	Open
Sequencing Center	Princeton University
Sequencing Status	Permanent Draft

Scaffold Components
Scaffold Length (bps)	5207
Total Scaffold Genes	8 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)	5 (62.50%)
Novel Protein Genes	1 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)	1 (100.00%)
Associated Families	1

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Betaproteobacteria → Nitrosomonadales → Thiobacillaceae → Thiobacillus → Thiobacillus denitrificans	(Source: IMG/M)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Deep Subsurface → Fracking Water → Unclassified → Fracture Fluid → Fracture Fluid Microbial Communities From Borehole On The 26 Level Of Beatrix Gold Mine, Welkom, South Africa

Source Dataset Sampling Location
Location Name	South Africa: Welkom
Coordinates	Lat. (^o)	-28.232288	Long. (^o)	26.794365	Alt. (m)		Depth (m)
Location on Map

Zoom:	Powered by OpenStreetMap^©

Associated Families

Family	Category	Number of Sequences	3D Structure?
F025775	Metagenome	200	Y

Sequences

Protein ID	Family	RBS	Sequence
Ga0246235_1019534	F025775	GGAG	MKQFLTFQGFPMVVVTALIVWAWISILSVLIASFF

© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.