NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Scaffold Ga0310915_10016967

Scaffold Ga0310915_10016967


Overview

Basic Information
Taxon OID3300031573 Open in IMG/M
Scaffold IDGa0310915_10016967 Open in IMG/M
Source Dataset NameLab enrichment of tropical soil microbial communities from Luquillo Experimental Forest, Puerto Rico - GRE.bulkMG.AN111
Source Dataset CategoryMetagenome
Source Dataset Use PolicyOpen
Sequencing CenterDOE Joint Genome Institute (JGI)
Sequencing StatusPermanent Draft

Scaffold Components
Scaffold Length (bps)4355
Total Scaffold Genes11 (view)
Total Scaffold Genes with Ribosome Binding Sites (RBS)11 (100.00%)
Novel Protein Genes3 (view)
Novel Protein Genes with Ribosome Binding Sites (RBS)3 (100.00%)
Associated Families3

Taxonomy
All Organisms → cellular organisms → Bacteria → Proteobacteria → Alphaproteobacteria → unclassified Alphaproteobacteria → Alphaproteobacteria bacterium(Source: UniRef50)

Ecosystem & Geography

Source Dataset Ecosystem
Environmental → Terrestrial → Soil → Unclassified → Forest Soil → Soil → Lab Enrichment Of Tropical Soil Microbial Communities From Luquillo Experimental Forest, Puerto Rico

Source Dataset Sampling Location
Location NamePuerto Rico: Rio Grande
CoordinatesLat. (o)18.321Long. (o)-65.8172Alt. (m)Depth (m)0
Location on Map
Zoom:    Powered by OpenStreetMap ©

Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F032796Metagenome / Metatranscriptome179Y
F035402Metagenome / Metatranscriptome172Y
F096134Metagenome / Metatranscriptome105N

Sequences

Protein IDFamilyRBSSequence
Ga0310915_100169672F035402AGGMWFYVQMLFPLLTVALTAAICLSVVSFIMGHAKPQR
Ga0310915_100169674F032796AGGAGMTKGYIVADVAIKTAYFSLVTAALIFVSMLLLAGVHP
Ga0310915_100169676F096134GGTGGMLTSKEYLQRAEECSQLANASSDVYVKKALTELACEFKATAKDLEQRNER

 ⦗Top⦘



© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.