NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Sample 3300001614

3300001614: Forest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF015



Overview

Basic Information
IMG/M Taxon OID3300001614 Open in IMG/M
GOLD Reference
(Study | Sequencing Project | Analysis Project)		Gs0085736 | Gp0057296 | Ga0003854
Sample NameForest soil microbial communities from Harvard Forest Long Term Ecological Research site in Petersham, Massachusetts, USA - MetaG HF015
Sequencing StatusPermanent Draft
Sequencing CenterDOE Joint Genome Institute (JGI)
Published?N
Use PolicyOpen

Dataset Contents
Total Genome Size4426136
Sequencing Scaffolds8
Novel Protein Genes8
Associated Families8

Dataset Phylogeny
Taxonomy GroupsNumber of Scaffolds
All Organisms → cellular organisms → Bacteria3
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium2
Not Available2
All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Ethanoligenens → Ethanoligenens harbinense1

Ecosystem and Geography

Ecosystem Assignment (GOLD)
NameForest Soil Microbial Communities From Harvard Forest Long Term Ecological Research (Lter) Site In Petersham, Ma, For Long-Term Soil Warming Studies
TypeEnvironmental
TaxonomyEnvironmental → Terrestrial → Soil → Loam → Forest Soil → Forest Soil → Forest Soil Microbial Communities From Harvard Forest Long Term Ecological Research (Lter) Site In Petersham, Ma, For Long-Term Soil Warming Studies

Alternative Ecosystem Assignments
Environment Ontology (ENVO)forest biome → land → forest soil
Earth Microbiome Project Ontology (EMPO)Free-living → Non-saline → Soil (non-saline)

Location Information
LocationHarvard Forest LTER, Petersham, MA, USA
CoordinatesLat. (o)42.532967Long. (o)-72.209488Alt. (m)N/ADepth (m)N/A
Location on Map
Zoom:    Powered by OpenStreetMap ©


Associated Families

FamilyCategoryNumber of Sequences3D Structure?
F019358Metagenome / Metatranscriptome230Y
F041450Metagenome / Metatranscriptome160Y
F053437Metagenome / Metatranscriptome141Y
F055918Metagenome / Metatranscriptome138Y
F058308Metagenome / Metatranscriptome135Y
F064134Metagenome / Metatranscriptome129Y
F064181Metagenome129Y
F075406Metagenome / Metatranscriptome119Y

Associated Scaffolds

ScaffoldTaxonomyLengthIMG/M Link
JGI20249J16330_100034All Organisms → cellular organisms → Bacteria1153Open in IMG/M
JGI20249J16330_100158All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium866Open in IMG/M
JGI20249J16330_100190All Organisms → cellular organisms → Bacteria → Terrabacteria group → Actinobacteria → Actinomycetia → unclassified Actinomycetia → Actinomycetia bacterium821Open in IMG/M
JGI20249J16330_100568Not Available653Open in IMG/M
JGI20249J16330_100684All Organisms → cellular organisms → Bacteria → Terrabacteria group → Firmicutes → Clostridia → Eubacteriales → Oscillospiraceae → Ethanoligenens → Ethanoligenens harbinense621Open in IMG/M
JGI20249J16330_100863All Organisms → cellular organisms → Bacteria588Open in IMG/M
JGI20249J16330_101148All Organisms → cellular organisms → Bacteria543Open in IMG/M
JGI20249J16330_101374Not Available513Open in IMG/M

Sequences

Scaffold IDProtein IDFamilySequence
JGI20249J16330_100034JGI20249J16330_1000341F064181VAGEGHGQSMNSAAIGIALVVLVVGCILGWHANRAHTAHGDIKTTHGRIAGYRKTRLKSGLWAIG
JGI20249J16330_100158JGI20249J16330_1001582F019358GGLILIVLAAVVVTQPGRYRVFVVTAVLTGLVFTAITSAFAWGGPGQPVTIKVEHGARYSTLPILLLDAALIVAADVCARRWPRPKAIVAVVALVAVLAVGWATDFRYPVRRLAGPASAWKTTANAWIRHCERKPAGTITVVFHDWWSTAPLDTTFSCTSLRR*
JGI20249J16330_100190JGI20249J16330_1001902F075406THQRWDAVRQDGDRADLRLVEERTLVPGAVATLVPPRDVHNHGHVAGSGPSPYSLILLGDNMLLFDREEYDPERGTWRALAAGXPGRDNR*
JGI20249J16330_100568JGI20249J16330_1005681F058308MPLWRIRIAVPDDPGSRDALNNVLATQPEARLRELPGRTATSVTTGEIVVELPQDDGLVGVLSALHQISPQVFVSRADMPEPAPGP*
JGI20249J16330_100684JGI20249J16330_1006841F053437VQSSRRLLRDTLSACLAVRPDITVVGKVAEPDAIFELCELRHPDVVIMDAGARLREISARVAALTKRYPELNVIVTYRD
JGI20249J16330_100863JGI20249J16330_1008632F041450LLRQALETFQRIGAAEAPDLLAELDTLTGPPPAR*
JGI20249J16330_101148JGI20249J16330_1011482F064134GHAERNLALIRQLEAETRELLARLDEPDLEQSAWLQEVTSAERQAGHHRRPETATAHPSIF*
JGI20249J16330_101374JGI20249J16330_1013741F055918QLRAAEWFEATGHTRRAAQHFWAAQQTDRALLLLQDRVVPDFLRVPTGPEPLVMSSVNPSMLTEPPDRLLGLAAHLLLSGDTAHGGEYLDLLEHAGKIPPDSALAARFAAFQSFRYGVTGQLERAVRAALAARTTQERRQLTDEWDITVPLVLIRVYTCLGDFPAAEREAA
 ⦗Top⦘



Bioinformatics & Integrated Biology Lab
Institute for Fundamental Biomedical Research
Biomedical Sciences Research Center "Alexander Fleming"
© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.