NMPFamsDB

NMPFamsDB

NMPFamsDB

A database of Novel Metagenome Protein Families

A database of Novel Metagenome Protein Clusters

A database of Novel Metagenome Protein Clusters
x
This website uses cookies to improve user experience. By using NMPFamDB you consent to all cookies in accordance with our privacy policy. OK
Metagenome Family F040685

Metagenome Family F040685

Go to section:
Overview Alignments Structure & Topology Gene Neighborhood Phylogeny Ecosystems Sequences
Select file to download:
   Download


Overview

Basic Information
Family ID F040685
Family Type Metagenome
Number of Sequences 161
Average Sequence Length 148 residues
Representative Sequence MKKLLFKLFFALAFASISLHGQEKIQQVEVHIFGGMALYSSQYTLNSLKKEFSAKPLMGQKEELPKEISLPNTPKNWEAFTKKINLDKFKKLRDGPSQQAFDGQDEVIIIKTDKKTYRKMNASGNDHDRKVWYDLLQIIAKEFGKKSIYE
Number of Associated Samples 124
Number of Associated Scaffolds 139

Quality Assessment
Transcriptomic Evidence No
Most common taxonomic group Bacteria
% of genes with valid RBS motifs 11.80 %
% of genes near scaffold ends (potentially truncated) 19.25 %
% of genes from short scaffolds (< 2000 bps) 34.78 %
Associated GOLD sequencing projects 113
AlphaFold2 3D model prediction No

Note: High quality evidence is represented by blue. Low quality evidence is represented by red.
Hidden Markov Model
Powered by Skylign

Most Common Taxonomy
Group Bacteria (100.000 % of family members)
NCBI Taxonomy ID 2
Taxonomy All Organisms → cellular organisms → Bacteria

Most Common Ecosystem
GOLD Ecosystem Host-Associated → Human → Digestive System → Oral Cavity → Supragingival Plaque → Human
(63.975 % of family members)
Environment Ontology (ENVO) Unclassified
(100.000 % of family members)
Earth Microbiome Project Ontology (EMPO) Host-associated → Animal → Animal surface
(92.547 % of family members)



 ⦗Top⦘

Multiple Sequence Alignments

Select alignment to view:      


 ⦗Top⦘

Structure & Topology

Predicted Secondary Structure and Topology

Predicted Topology & Secondary Structure
Classification: Globular Signal Peptide: Yes Secondary Structure distribution: α-helix: 30.00%    β-sheet: 24.00%    Coil/Unstructured: 46.00%
Feature Viewer
Powered by Feature Viewer


 ⦗Top⦘

Gene Neighborhood

Neighboring Pfam domains

Pfam IDName % Frequency in 139 Family Scaffolds
PF00293NUDIX 24.46
PF01571GCV_T 5.04
PF08669GCV_T_C 4.32
PF02195ParBc 3.60
PF05175MTS 3.60
PF13522GATase_6 3.60
PF16193AAA_assoc_2 2.88
PF14092DUF4270 2.88
PF03781FGE-sulfatase 2.16
PF05173DapB_C 2.16
PF003892-Hacid_dh 2.16
PF028262-Hacid_dh_C 2.16
PF08323Glyco_transf_5 2.16
PF02347GDC-P 1.44
PF00154RecA 1.44
PF13568OMP_b-brl_2 0.72
PF09919DUF2149 0.72
PF01520Amidase_3 0.72
PF01168Ala_racemase_N 0.72
PF01656CbiA 0.72
PF01040UbiA 0.72
PF12081GldM_N 0.72
PF01408GFO_IDH_MocA 0.72
PF13614AAA_31 0.72
PF03721UDPG_MGDP_dh_N 0.72
PF01709Transcrip_reg 0.72
PF01266DAO 0.72
PF10502Peptidase_S26 0.72
PF02569Pantoate_ligase 0.72
PF02899Phage_int_SAM_1 0.72
PF02773S-AdoMet_synt_C 0.72

Neighboring Clusters of Orthologous Genes (COGs)

COG IDNameFunctional Category % Frequency in 139 Family Scaffolds
COG02894-hydroxy-tetrahydrodipicolinate reductaseAmino acid transport and metabolism [E] 2.16
COG0297Glycogen synthaseCarbohydrate transport and metabolism [G] 2.16
COG0438Glycosyltransferase involved in cell wall bisynthesisCell wall/membrane/envelope biogenesis [M] 2.16
COG1262Formylglycine-generating enzyme, required for sulfatase activity, contains SUMF1/FGE domainPosttranslational modification, protein turnover, chaperones [O] 2.16
COG0403Glycine cleavage system protein P (pyridoxal-binding), N-terminal domainAmino acid transport and metabolism [E] 1.44
COG0468RecA/RadA recombinaseReplication, recombination and repair [L] 1.44
COG1003Glycine cleavage system protein P (pyridoxal-binding), C-terminal domainAmino acid transport and metabolism [E] 1.44
COG0192S-adenosylmethionine synthetaseCoenzyme transport and metabolism [H] 0.72
COG0217Transcriptional and/or translational regulatory protein YebC/TACO1Translation, ribosomal structure and biogenesis [J] 0.72
COG0240Glycerol-3-phosphate dehydrogenaseEnergy production and conversion [C] 0.72
COG0414Panthothenate synthetaseCoenzyme transport and metabolism [H] 0.72
COG0677UDP-N-acetyl-D-mannosaminuronate dehydrogenaseCell wall/membrane/envelope biogenesis [M] 0.72
COG0860N-acetylmuramoyl-L-alanine amidaseCell wall/membrane/envelope biogenesis [M] 0.72
COG1004UDP-glucose 6-dehydrogenaseCell wall/membrane/envelope biogenesis [M] 0.72
COG12503-hydroxyacyl-CoA dehydrogenaseLipid transport and metabolism [I] 0.72
COG1893Ketopantoate reductaseCoenzyme transport and metabolism [H] 0.72
COG4973Site-specific recombinase XerCReplication, recombination and repair [L] 0.72
COG4974Site-specific recombinase XerDReplication, recombination and repair [L] 0.72


 ⦗Top⦘

Phylogeny

NCBI Taxonomy

Select NCBI taxonomy Level:
NameRankTaxonomyDistribution
All OrganismsrootAll Organisms100.00 %
UnclassifiedrootN/A0.00 %

Visualization
Powered by ApexCharts

Associated Scaffolds


ScaffoldTaxonomyLengthIMG/M Link
2124908010|kg300_3269143All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae3581Open in IMG/M
3300006249|Ga0099390_1000259All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Weeksellaceae39487Open in IMG/M
3300006249|Ga0099390_1036360All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium774Open in IMG/M
3300006250|Ga0099391_100345All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Weeksellaceae42444Open in IMG/M
3300006251|Ga0099392_120773All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium957Open in IMG/M
3300006253|Ga0099372_1020164All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Weeksellaceae → Chryseobacterium group → Chryseobacterium1484Open in IMG/M
3300006255|Ga0099353_1002379All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Weeksellaceae7172Open in IMG/M
3300006255|Ga0099353_1002379All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Weeksellaceae7172Open in IMG/M
3300006261|Ga0099521_104720All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales2134Open in IMG/M
3300006295|Ga0099657_100357All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Weeksellaceae11735Open in IMG/M
3300006301|Ga0099617_113269All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1221Open in IMG/M
3300006317|Ga0099674_100251All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Weeksellaceae48510Open in IMG/M
3300006328|Ga0099580_100136All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Weeksellaceae39382Open in IMG/M
3300006457|Ga0100214_112714All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1117Open in IMG/M
3300006459|Ga0100222_100782All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Weeksellaceae15257Open in IMG/M
3300006461|Ga0100060_100719All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Weeksellaceae19179Open in IMG/M
3300006479|Ga0100247_1010878All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Weeksellaceae → Chryseobacterium group → Chryseobacterium3132Open in IMG/M
3300006498|Ga0100374_103573All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Weeksellaceae6590Open in IMG/M
3300006742|Ga0101805_119865All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium575Open in IMG/M
3300006744|Ga0101797_1000418All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Weeksellaceae14541Open in IMG/M
3300006744|Ga0101797_1010789All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium2108Open in IMG/M
3300006744|Ga0101797_1010789All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium2108Open in IMG/M
3300006745|Ga0101799_100525All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Weeksellaceae → Chryseobacterium group → Chryseobacterium19116Open in IMG/M
3300007066|Ga0103285_111825All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium656Open in IMG/M
3300007091|Ga0104058_103849All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Weeksellaceae → Chryseobacterium group → Chryseobacterium2545Open in IMG/M
3300007093|Ga0104055_1000094All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Weeksellaceae32199Open in IMG/M
3300007119|Ga0102640_1000140All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Weeksellaceae48638Open in IMG/M
3300007121|Ga0102671_143372All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium516Open in IMG/M
3300007126|Ga0102717_100311All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Weeksellaceae38168Open in IMG/M
3300007204|Ga0103275_129137All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium552Open in IMG/M
3300007208|Ga0103291_124117All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium787Open in IMG/M
3300007287|Ga0104873_130290All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium520Open in IMG/M
3300007297|Ga0104793_100030All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Weeksellaceae165859Open in IMG/M
3300007316|Ga0104922_127251All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales880Open in IMG/M
3300007317|Ga0104967_100246All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Weeksellaceae28079Open in IMG/M
3300007317|Ga0104967_100246All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Weeksellaceae28079Open in IMG/M
3300007320|Ga0104940_1001889All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Weeksellaceae11955Open in IMG/M
3300007320|Ga0104940_1003982All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Weeksellaceae → Chryseobacterium group → Chryseobacterium6679Open in IMG/M
3300007320|Ga0104940_1003982All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Weeksellaceae → Chryseobacterium group → Chryseobacterium6679Open in IMG/M
3300007347|Ga0104340_100167All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Weeksellaceae32092Open in IMG/M
3300007357|Ga0104764_100461All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Weeksellaceae22998Open in IMG/M
3300007368|Ga0104977_1043391All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium869Open in IMG/M
3300007500|Ga0104983_100019All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Weeksellaceae221753Open in IMG/M
3300007500|Ga0104983_141246All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium636Open in IMG/M
3300007531|Ga0105502_1000098All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Weeksellaceae80464Open in IMG/M
3300007566|Ga0104970_1017584All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales1940Open in IMG/M
3300007638|Ga0105526_1003975All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Weeksellaceae5749Open in IMG/M
3300007638|Ga0105526_1022041All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1391Open in IMG/M
3300007646|Ga0105530_1000605All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Weeksellaceae27469Open in IMG/M
3300007646|Ga0105530_1000605All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Weeksellaceae27469Open in IMG/M
3300007666|Ga0105543_1005628All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Weeksellaceae → Chryseobacterium group → Chryseobacterium3703Open in IMG/M
3300007711|Ga0105642_1004444All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales3390Open in IMG/M
3300007732|Ga0105756_100402All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Weeksellaceae30704Open in IMG/M
3300007732|Ga0105756_100402All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Weeksellaceae30704Open in IMG/M
3300007732|Ga0105756_100756All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Weeksellaceae20282Open in IMG/M
3300007736|Ga0105757_1006828All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Weeksellaceae → Chryseobacterium group → Chryseobacterium3855Open in IMG/M
3300007746|Ga0105776_1031743All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1107Open in IMG/M
3300007791|Ga0105806_1004020All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Weeksellaceae6832Open in IMG/M
3300007791|Ga0105806_1004020All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Weeksellaceae6832Open in IMG/M
3300007925|Ga0113553_100356All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Weeksellaceae34704Open in IMG/M
3300007925|Ga0113553_100356All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Weeksellaceae34704Open in IMG/M
3300007926|Ga0113866_121523All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium513Open in IMG/M
3300007940|Ga0114257_100156All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Weeksellaceae63642Open in IMG/M
3300007968|Ga0105969_100194All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Weeksellaceae36178Open in IMG/M
3300007980|Ga0114366_1055868All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium522Open in IMG/M
3300007997|Ga0111053_100015All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Weeksellaceae168559Open in IMG/M
3300007997|Ga0111053_100015All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Weeksellaceae168559Open in IMG/M
3300008073|Ga0114851_1053352All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium508Open in IMG/M
3300008075|Ga0114853_100565All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Weeksellaceae16192Open in IMG/M
3300008075|Ga0114853_100565All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Weeksellaceae16192Open in IMG/M
3300008082|Ga0105968_1011123All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Weeksellaceae → Chryseobacterium group → Chryseobacterium1565Open in IMG/M
3300008083|Ga0105970_100003All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Weeksellaceae400940Open in IMG/M
3300008083|Ga0105970_100003All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Weeksellaceae400940Open in IMG/M
3300008089|Ga0104978_1016496All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales1882Open in IMG/M
3300008102|Ga0114249_1000156All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Weeksellaceae29078Open in IMG/M
3300008102|Ga0114249_1037750All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium758Open in IMG/M
3300008133|Ga0111365_129196All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium892Open in IMG/M
3300008140|Ga0114165_1001972All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Weeksellaceae12311Open in IMG/M
3300008140|Ga0114165_1001972All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Weeksellaceae12311Open in IMG/M
3300008142|Ga0114286_1040398All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales1260Open in IMG/M
3300008144|Ga0114284_1000838All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Weeksellaceae22560Open in IMG/M
3300008147|Ga0114367_113725All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales1611Open in IMG/M
3300008152|Ga0114285_1013047All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales2592Open in IMG/M
3300008152|Ga0114285_1013047All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales2592Open in IMG/M
3300008159|Ga0114019_1001552All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Weeksellaceae10850Open in IMG/M
3300008159|Ga0114019_1040030All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium831Open in IMG/M
3300008160|Ga0114158_1000070All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Weeksellaceae42937Open in IMG/M
3300008271|Ga0111085_116682All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1622Open in IMG/M
3300008271|Ga0111085_116682All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1622Open in IMG/M
3300008334|Ga0115372_1000612All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Weeksellaceae11865Open in IMG/M
3300008334|Ga0115372_1000612All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Weeksellaceae11865Open in IMG/M
3300008341|Ga0115381_100023All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Weeksellaceae166390Open in IMG/M
3300008341|Ga0115381_100023All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Weeksellaceae166390Open in IMG/M
3300008347|Ga0115411_1000018All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Weeksellaceae175578Open in IMG/M
3300008348|Ga0115412_101393All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales3127Open in IMG/M
3300008363|Ga0115180_107671All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium2529Open in IMG/M
3300008403|Ga0115182_129151All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium503Open in IMG/M
3300008406|Ga0115224_1000004All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Weeksellaceae313118Open in IMG/M
3300008408|Ga0115077_102003All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Weeksellaceae9753Open in IMG/M
3300008480|Ga0115173_1002036All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Weeksellaceae12273Open in IMG/M
3300008480|Ga0115173_1002036All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Weeksellaceae12273Open in IMG/M
3300008481|Ga0115177_1002220All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Weeksellaceae10540Open in IMG/M
3300008481|Ga0115177_1002220All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Weeksellaceae10540Open in IMG/M
3300008486|Ga0115196_1027586All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1302Open in IMG/M
3300008486|Ga0115196_1048859All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium714Open in IMG/M
3300008495|Ga0114893_110938All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales1205Open in IMG/M
3300008505|Ga0111014_100891All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Weeksellaceae9186Open in IMG/M
3300008506|Ga0115176_1026353All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales1432Open in IMG/M
3300008506|Ga0115176_1043529All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium832Open in IMG/M
3300008518|Ga0115191_100756All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Weeksellaceae19957Open in IMG/M
3300008556|Ga0111059_100577All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Weeksellaceae21267Open in IMG/M
3300008575|Ga0111079_103288All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Weeksellaceae → Chryseobacterium group → Chryseobacterium7945Open in IMG/M
3300008628|Ga0111366_101415All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Weeksellaceae7843Open in IMG/M
3300008634|Ga0111369_1001112All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Weeksellaceae18038Open in IMG/M
3300008634|Ga0111369_1001112All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Weeksellaceae18038Open in IMG/M
3300008635|Ga0115679_100042All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Weeksellaceae96455Open in IMG/M
3300008639|Ga0115685_1003774All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Weeksellaceae → Chryseobacterium group → Chryseobacterium8776Open in IMG/M
3300008645|Ga0111425_104285All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Weeksellaceae5477Open in IMG/M
3300008645|Ga0111425_104483All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Weeksellaceae5276Open in IMG/M
3300008645|Ga0111425_104483All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Weeksellaceae5276Open in IMG/M
3300008650|Ga0111455_1016967All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales1714Open in IMG/M
3300008679|Ga0115430_1009147All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Weeksellaceae → Chryseobacterium group → Chryseobacterium3470Open in IMG/M
3300008679|Ga0115430_1062376All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium609Open in IMG/M
3300008680|Ga0111555_1000429All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Weeksellaceae34315Open in IMG/M
3300008695|Ga0113557_100065All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Weeksellaceae97462Open in IMG/M
3300008700|Ga0113865_119491All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium736Open in IMG/M
3300008729|Ga0113885_100239All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Weeksellaceae19777Open in IMG/M
3300008743|Ga0114022_1000037All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Weeksellaceae100149Open in IMG/M
3300008743|Ga0114022_1000895All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Weeksellaceae18909Open in IMG/M
3300008746|Ga0114084_1034940All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium901Open in IMG/M
3300009363|Ga0115223_1005677All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Weeksellaceae5116Open in IMG/M
3300009393|Ga0111010_1006950All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Weeksellaceae4363Open in IMG/M
3300009393|Ga0111010_1048450All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium943Open in IMG/M
3300011914|Ga0119804_100002All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Weeksellaceae229166Open in IMG/M
3300011914|Ga0119804_100002All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Weeksellaceae229166Open in IMG/M
3300011925|Ga0119789_102297All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales4069Open in IMG/M
3300011925|Ga0119789_102297All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales4069Open in IMG/M
3300011925|Ga0119789_113075All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales957Open in IMG/M
3300011928|Ga0119808_105805All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium2104Open in IMG/M
3300011970|Ga0119794_1035557All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium618Open in IMG/M
3300011972|Ga0119788_1006078All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Weeksellaceae → Chryseobacterium group → Chryseobacterium3910Open in IMG/M
3300011981|Ga0119778_1065508All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium573Open in IMG/M
3300013749|Ga0119799_128719All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium682Open in IMG/M
3300013751|Ga0119802_1043782All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium549Open in IMG/M
3300014024|Ga0119801_113540All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales1304Open in IMG/M
7000000039|SRS013164_Baylor_scaffold_42233All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales2655Open in IMG/M
7000000061|C3039953All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium553Open in IMG/M
7000000085|SRS018145_Baylor_scaffold_36207All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium552Open in IMG/M
7000000119|SRS023964_Baylor_scaffold_63463All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium1082Open in IMG/M
7000000156|C2511816All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales899Open in IMG/M
7000000194|SRS022077_Baylor_scaffold_56510All Organisms → cellular organisms → Bacteria20403Open in IMG/M
7000000195|SRS017209_Baylor_scaffold_59150All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae27944Open in IMG/M
7000000240|C3664095All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae2940Open in IMG/M
7000000286|C2656674All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Weeksellaceae → Chryseobacterium group → Chryseobacterium → Chryseobacterium gleum5909Open in IMG/M
7000000324|C3109720All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales1128Open in IMG/M
7000000354|SRS015985_WUGC_scaffold_31175All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium930Open in IMG/M
7000000446|C1522394All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium966Open in IMG/M
7000000496|SRS057692_LANL_scaffold_27373All Organisms → cellular organisms → Bacteria11465Open in IMG/M
7000000599|SRS019022_WUGC_scaffold_61976All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales978Open in IMG/M
7000000638|C1523969All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales → Flavobacteriaceae → unclassified Flavobacteriaceae → Flavobacteriaceae bacterium543Open in IMG/M
7000000677|SRS049389_WUGC_scaffold_43348All Organisms → cellular organisms → Bacteria → FCB group → Bacteroidetes/Chlorobi group → Bacteroidetes → Flavobacteriia → Flavobacteriales1877Open in IMG/M



 ⦗Top⦘

Environmental Properties

Associated Habitat Types

Select Environment Taxonomy Level:
HabitatTaxonomyDistribution
HumanHost-Associated → Human → Digestive System → Oral Cavity → Supragingival Plaque → Human63.98%
HumanHost-Associated → Human → Digestive System → Oral Cavity → Tongue Dorsum → Human19.25%
Human OralHost-Associated → Human → Digestive System → Oral Cavity → Subgingival Plaque → Human Oral7.45%
HumanHost-Associated → Human → Digestive System → Oral Cavity → Buccal Mucosa → Human4.35%
HumanHost-Associated → Human → Digestive System → Oral Cavity → Attached/Keratinized Gingiva → Human1.86%
HumanHost-Associated → Human → Digestive System → Oral Cavity → Subgingival Plaque → Human0.62%
HumanHost-Associated → Human → Digestive System → Oral Cavity → Palatine Tonsils → Human0.62%
HumanHost-Associated → Human → Digestive System → Oral Cavity → Throat → Human0.62%
Keratinized GingivaHost-Associated → Human → Digestive System → Oral Cavity → Unclassified → Keratinized Gingiva0.62%
HumanHost-Associated → Human → Digestive System → Oral Cavity → Hard Palate → Human0.62%

Visualization
Powered by ApexCharts



Associated Samples

Taxon OIDSample NameHabitat TypeIMG/M Link
2124908010Keratinized_gingiva_contig300Host-AssociatedOpen in IMG/M
3300006249Human supragingival plaque microbial communities from NIH, USA - visit 1, subject 764508039Host-AssociatedOpen in IMG/M
3300006250Human tongue dorsum microbial communities from NIH, USA - visit 2, subject 159510762Host-AssociatedOpen in IMG/M
3300006251Human tongue dorsum microbial communities from NIH, USA - visit 2, subject 159369152Host-AssociatedOpen in IMG/M
3300006253Human supragingival plaque microbial communities from NIH, USA - visit 2, subject 159510762Host-AssociatedOpen in IMG/M
3300006255Human supragingival plaque microbial communities from NIH, USA - visit 1, subject 737052003Host-AssociatedOpen in IMG/M
3300006261Human supragingival plaque microbial communities from NIH, USA - visit 1, subject 764588959Host-AssociatedOpen in IMG/M
3300006295Human supragingival plaque microbial communities from NIH, USA - visit 1, subject 160603188Host-AssociatedOpen in IMG/M
3300006301Human buccal mucosa microbial communities from NIH, USA - visit 2 of subject 764224817Host-AssociatedOpen in IMG/M
3300006317Human supragingival plaque microbial communities from NIH, USA - visit 1, subject 370425937Host-AssociatedOpen in IMG/M
3300006328Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 763860675Host-AssociatedOpen in IMG/M
3300006457Human supragingival plaque microbial communities from NIH, USA - visit 1, subject 765337473Host-AssociatedOpen in IMG/M
3300006459Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 159369152Host-AssociatedOpen in IMG/M
3300006461Human supragingival plaque microbial communities from NIH, USA - visit 1, subject 158742018Host-AssociatedOpen in IMG/M
3300006479Human supragingival plaque microbial communities from NIH, USA - visit 1, subject 159369152Host-AssociatedOpen in IMG/M
3300006498Human supragingival plaque microbial communities from NIH, USA - visit 1, subject 159591683Host-AssociatedOpen in IMG/M
3300006742Human buccal mucosa microbial communities from NIH, USA - visit 1, subject 160158126Host-AssociatedOpen in IMG/M
3300006744Human supragingival plaque microbial communities from NIH, USA - visit 2, subject 158256496Host-AssociatedOpen in IMG/M
3300006745Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 160158126Host-AssociatedOpen in IMG/M
3300007066Human supragingival plaque microbial communities from NIH, USA - visit 1, subject 160765029Host-AssociatedOpen in IMG/M
3300007091Human supragingival plaque microbial communities from NIH, USA - visit 1, subject 764042746Host-AssociatedOpen in IMG/M
3300007093Human supragingival plaque microbial communities from NIH, USA - visit 2, subject 763820215Host-AssociatedOpen in IMG/M
3300007119Human supragingival plaque microbial communities from NIH, USA - visit 2, subject 763860675Host-AssociatedOpen in IMG/M
3300007121Human supragingival plaque microbial communities from NIH, USA - visit 2, subject 158944319Host-AssociatedOpen in IMG/M
3300007126Human supragingival plaque microbial communities from NIH, USA - visit 1, subject 158337416Host-AssociatedOpen in IMG/M
3300007204Human supragingival plaque microbial communities from NIH, USA - visit 1, subject 763961826Host-AssociatedOpen in IMG/M
3300007208Human tongue dorsum microbial communities from NIH, USA - visit 2, subject 763901136 replicate 1Host-AssociatedOpen in IMG/M
3300007287Human buccal mucosa microbial communities from NIH, USA - visit 1, subject 158742018 reassemblyHost-AssociatedOpen in IMG/M
3300007297Human tongue dorsum microbial communities from NIH, USA - visit 2, subject 158337416 reassemblyHost-AssociatedOpen in IMG/M
3300007316Human tongue dorsum microbial communities from NIH, USA - visit 2, subject 159571453 reassemblyHost-AssociatedOpen in IMG/M
3300007317Human supragingival plaque microbial communities from NIH, USA - visit 1, subject 763759525 reassemblyHost-AssociatedOpen in IMG/M
3300007320Human supragingival plaque microbial communities from NIH, USA - visit 1, subject 158479027 reassemblyHost-AssociatedOpen in IMG/M
3300007347Human supragingival plaque microbial communities from NIH, USA - visit 1, subject 764649650 reassemblyHost-AssociatedOpen in IMG/M
3300007357Human supragingival plaque microbial communities from NIH, USA - visit 1, subject 160319967 reassemblyHost-AssociatedOpen in IMG/M
3300007368Human supragingival plaque microbial communities from NIH, USA - visit 2, subject 158499257 reassemblyHost-AssociatedOpen in IMG/M
3300007500Human supragingival plaque microbial communities from NIH, USA - visit 1, subject 763840445 reassemblyHost-AssociatedOpen in IMG/M
3300007531Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 764224817 reassemblyHost-AssociatedOpen in IMG/M
3300007566Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 763840445 reassemblyHost-AssociatedOpen in IMG/M
3300007638Human supragingival plaque microbial communities from NIH, USA - visit 1, subject 159915365 reassemblyHost-AssociatedOpen in IMG/M
3300007646Human supragingival plaque microbial communities from NIH, USA - visit 2, subject 763840445 reassemblyHost-AssociatedOpen in IMG/M
3300007666Human supragingival plaque microbial communities from NIH, USA - visit 1, subject 765074482 reassemblyHost-AssociatedOpen in IMG/M
3300007711Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 160502038 reassemblyHost-AssociatedOpen in IMG/M
3300007732Human supragingival plaque microbial communities from NIH, USA - visit number 3 of subject 158883629 reassemblyHost-AssociatedOpen in IMG/M
3300007736Human supragingival plaque microbial communities from NIH, USA - visit 1, subject 604812005 reassemblyHost-AssociatedOpen in IMG/M
3300007746Human supragingival plaque microbial communities from NIH, USA - visit 1, subject 160502038 reassemblyHost-AssociatedOpen in IMG/M
3300007791Human supragingival plaque microbial communities from NIH, USA - visit 1, subject 159268001 reassemblyHost-AssociatedOpen in IMG/M
3300007925Human supragingival plaque microbial communities from NIH, USA - visit 2, subject 763435843 reassemblyHost-AssociatedOpen in IMG/M
3300007926Human buccal mucosa microbial communities from NIH, USA - visit 2, subject 763901136 reassemblyHost-AssociatedOpen in IMG/M
3300007940Human attached/keratinized gingiva microbial communities from NIH, USA - visit 2, subject 763496533 reassemblyHost-AssociatedOpen in IMG/M
3300007968Human buccal mucosa microbial communities from NIH, USA - visit 1, subject 764447348 reassemblyHost-AssociatedOpen in IMG/M
3300007980Human supragingival plaque microbial communities from NIH, USA - visit 2, subject 159207311 reassemblyHost-AssociatedOpen in IMG/M
3300007997Human supragingival plaque microbial communities from NIH, USA - visit 2, subject 764083206 reassemblyHost-AssociatedOpen in IMG/M
3300008073Human supragingival plaque microbial communities from NIH, USA - visit 2, subject 158883629 reassemblyHost-AssociatedOpen in IMG/M
3300008075Human supragingival plaque microbial communities from NIH, USA - visit 1, subject 765620695 reassemblyHost-AssociatedOpen in IMG/M
3300008082Human supragingival plaque microbial communities from NIH, USA - visit 2, subject 158337416 reassemblyHost-AssociatedOpen in IMG/M
3300008083Human supragingival plaque microbial communities from NIH, USA - visit 1, subject 764447348 reassemblyHost-AssociatedOpen in IMG/M
3300008089Human supragingival plaque microbial communities from NIH, USA - visit 1, subject 764285508 reassemblyHost-AssociatedOpen in IMG/M
3300008102Human supragingival plaque microbial communities from NIH, USA - visit 1, subject 404239096 reassemblyHost-AssociatedOpen in IMG/M
3300008133Human tongue dorsum microbial communities from NIH, USA - visit 2, subject 763840445 reassemblyHost-AssociatedOpen in IMG/M
3300008140Human supragingival plaque microbial communities from NIH, USA - visit 2, subject 763496533 reassemblyHost-AssociatedOpen in IMG/M
3300008142Human supragingival plaque microbial communities from NIH, USA - visit 1, subject 159814214 reassemblyHost-AssociatedOpen in IMG/M
3300008144Human supragingival plaque microbial communities from NIH, USA - visit 2, subject 764143897 reassemblyHost-AssociatedOpen in IMG/M
3300008147Human tongue dorsum microbial communities from NIH, USA - visit 2, subject 763961826 replicate 1 reassemblyHost-AssociatedOpen in IMG/M
3300008152Human supragingival plaque microbial communities from NIH, USA - visit 1, subject 160582958 reassemblyHost-AssociatedOpen in IMG/M
3300008159Human supragingival plaque microbial communities from NIH, USA - visit 1, subject 160178356 reassemblyHost-AssociatedOpen in IMG/M
3300008160Human subgingival plaque microbial communities from NIH, USA - visit 2, subject 763496533 reassemblyHost-AssociatedOpen in IMG/M
3300008271Human supragingival plaque microbial communities from NIH, USA - visit 2, subject 638754422 reassemblyHost-AssociatedOpen in IMG/M
3300008334Human supragingival plaque microbial communities from NIH, USA - visit 1, subject 765560005 reassemblyHost-AssociatedOpen in IMG/M
3300008341Human supragingival plaque microbial communities from NIH, USA - visit 2, subject 159247771 reassemblyHost-AssociatedOpen in IMG/M
3300008347Human supragingival plaque microbial communities from NIH, USA - visit 2, subject 764892411 reassemblyHost-AssociatedOpen in IMG/M
3300008348Human buccal mucosa microbial communities from NIH, USA - visit 2, subject 159268001 reassemblyHost-AssociatedOpen in IMG/M
3300008363Human supragingival plaque microbial communities from NIH, USA - visit 1, subject 764305738 reassemblyHost-AssociatedOpen in IMG/M
3300008403Human supragingival plaque microbial communities from NIH, USA - visit 2, subject 764042746 reassemblyHost-AssociatedOpen in IMG/M
3300008406Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 765701615 reassemblyHost-AssociatedOpen in IMG/M
3300008408Human supragingival plaque microbial communities from NIH, USA - visit 1, subject 763982056 reassemblyHost-AssociatedOpen in IMG/M
3300008480Human supragingival plaque microbial communities from NIH, USA - visit 2, subject 160158126 reassemblyHost-AssociatedOpen in IMG/M
3300008481Human supragingival plaque microbial communities from NIH, USA - visit 1, subject 160400887 reassemblyHost-AssociatedOpen in IMG/M
3300008486Human supragingival plaque microbial communities from NIH, USA - visit 1, subject 160158126 reassemblyHost-AssociatedOpen in IMG/M
3300008495Human attached/keratinized gingiva microbial communities from NIH, USA - visit 2, subject 763577454 reassemblyHost-AssociatedOpen in IMG/M
3300008505Human supragingival plaque microbial communities from NIH, USA - visit 2, subject 764224817 reassemblyHost-AssociatedOpen in IMG/M
3300008506Human tongue dorsum microbial communities from NIH, USA - visit number 3 of subject 159510762 reassemblyHost-AssociatedOpen in IMG/M
3300008518Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 764508039 reassemblyHost-AssociatedOpen in IMG/M
3300008556Human tongue dorsum microbial communities from NIH, USA - visit 2, subject 159591683 reassemblyHost-AssociatedOpen in IMG/M
3300008575Human tongue dorsum microbial communities from NIH, USA - visit 2, subject 764083206 reassemblyHost-AssociatedOpen in IMG/M
3300008628Human palatine tonsils microbial communities from NIH, USA - visit 1, subject 763496533 reassemblyHost-AssociatedOpen in IMG/M
3300008634Human supragingival plaque microbial communities from NIH, USA - visit 1, subject 765701615 reassemblyHost-AssociatedOpen in IMG/M
3300008635Human supragingival plaque microbial communities from NIH, USA - visit 1, subject 763901136 reassemblyHost-AssociatedOpen in IMG/M
3300008639Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 764083206 reassemblyHost-AssociatedOpen in IMG/M
3300008645Human supragingival plaque microbial communities from NIH, USA - visit 1, subject 763496533 reassemblyHost-AssociatedOpen in IMG/M
3300008650Human supragingival plaque microbial communities from NIH, USA - visit 1, subject 764143897 reassemblyHost-AssociatedOpen in IMG/M
3300008679Human supragingival plaque microbial communities from NIH, USA - visit 1, subject 763577454 reassemblyHost-AssociatedOpen in IMG/M
3300008680Human supragingival plaque microbial communities from NIH, USA - visit 2, subject 763901136 reassemblyHost-AssociatedOpen in IMG/M
3300008695Human supragingival plaque microbial communities from NIH, USA - visit 1, subject 764083206 replicate 1 reassemblyHost-AssociatedOpen in IMG/M
3300008700Human supragingival plaque microbial communities from NIH, USA - visit 1, subject 159753524 reassemblyHost-AssociatedOpen in IMG/M
3300008729Human supragingival plaque microbial communities from NIH, USA - visit 2, subject 764487809 reassemblyHost-AssociatedOpen in IMG/M
3300008743Human supragingival plaque microbial communities from NIH, USA - visit 2, subject 159591683 reassemblyHost-AssociatedOpen in IMG/M
3300008746Human supragingival plaque microbial communities from NIH, USA - visit 2, subject 159611913 reassemblyHost-AssociatedOpen in IMG/M
3300009363Human supragingival plaque microbial communities from NIH, USA - visit 1, subject 765013792 reassemblyHost-AssociatedOpen in IMG/M
3300009393Human supragingival plaque microbial communities from NIH, USA - visit 2, subject 159814214 reassemblyHost-AssociatedOpen in IMG/M
3300011914Human oral microbial communities from Los Angeles, CA, USA - S14-04-RHost-AssociatedOpen in IMG/M
3300011925Human oral microbial communities from Los Angeles, CA, USA - S04-07-RHost-AssociatedOpen in IMG/M
3300011928Human oral microbial communities from Los Angeles, CA, USA - S17-04-RHost-AssociatedOpen in IMG/M
3300011970Human oral microbial communities from Los Angeles, CA, USA - S12-02-DHost-AssociatedOpen in IMG/M
3300011972Human oral microbial communities from Los Angeles, CA, USA - S04-06-RHost-AssociatedOpen in IMG/M
3300011981Human oral microbial communities from Los Angeles, CA, USA - S01-02-DHost-AssociatedOpen in IMG/M
3300013749Human oral microbial communities from Los Angeles, CA, USA - S13-03-RHost-AssociatedOpen in IMG/M
3300013751Human oral microbial communities from Los Angeles, CA, USA - S14-02-DHost-AssociatedOpen in IMG/M
3300014024Human oral microbial communities from Los Angeles, CA, USA - S14-01-DHost-AssociatedOpen in IMG/M
7000000039Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 159369152Host-AssociatedOpen in IMG/M
7000000061Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 763860675Host-AssociatedOpen in IMG/M
7000000085Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 160158126Host-AssociatedOpen in IMG/M
7000000119Human supragingival plaque microbial communities from NIH, USA - visit 2, subject 159369152Host-AssociatedOpen in IMG/M
7000000156Human tongue dorsum microbial communities from NIH, USA - visit 2, subject 763901136 replicate 1Host-AssociatedOpen in IMG/M
7000000194Human tongue dorsum microbial communities from NIH, USA - visit 2, subject 158337416Host-AssociatedOpen in IMG/M
7000000195Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 159814214Host-AssociatedOpen in IMG/M
7000000240Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 764224817Host-AssociatedOpen in IMG/M
7000000286Human tongue dorsum microbial communities from NIH, USA - visit 2, subject 159510762Host-AssociatedOpen in IMG/M
7000000324Human hard palate microbial communities from NIH, USA - visit 2, subject 765560005Host-AssociatedOpen in IMG/M
7000000354Human buccal mucosa microbial communities from NIH, USA - visit 1, subject 764447348Host-AssociatedOpen in IMG/M
7000000446Human throat microbial communities from NIH, USA - visit 1, subject 763496533Host-AssociatedOpen in IMG/M
7000000496Human tongue dorsum microbial communities from NIH, USA - visit 2, subject 160158126Host-AssociatedOpen in IMG/M
7000000599Human tongue dorsum microbial communities from NIH, USA - visit 2, subject 763961826 replicate 1Host-AssociatedOpen in IMG/M
7000000638Human attached/keratinized gingiva microbial communities from NIH, USA - visit 2, subject 763577454Host-AssociatedOpen in IMG/M
7000000677Human tongue dorsum microbial communities from NIH, USA - visit 1, subject 765701615Host-AssociatedOpen in IMG/M

Geographical Distribution
Zoom:     Powered by OpenStreetMap



 ⦗Top⦘

Family Sequences

Protein ID Sample Taxon ID Habitat Sequence
kg300_005245702124908010Keratinized GingivaMKKLLFKLFFALAFASISLHGQEKIQQVEFNSFGGMALYSSQYTLNSLKKEFSAKPLMGQNEDLPKEISLPNTPKNWEAFTKKINLNKFKKLREGPSQQAFDGQDEVIIIKTDKKTYRKMNASGNDHDREVWYDLLKIIAKEFGKKGIYE
Ga0099390_1000259363300006249HumanMKKLLFKLFFALAFASISLHGQEKIQQVEFSSFGGRALYSSRYTLNSLKKEFSTKPLMGQNEDLPKEISLPNTPKNWEAFTKKINLNKFKKLRDGPSQQAFDEHDEVIIIKTDKKTYRKMNTSGNDHDREVWYDLLKIIAKEFGKKGVYE*
Ga0099390_103636023300006249HumanMKKLLFKLFFALAFTSISLHGQEKILQVEFSSFKGMALYSRQYTLNSLKKEFSAKPLMGQKEELSKEVSLPNTPKNWETFTKKINLDKFKKLRDCPSEQAFGGQDKVIIIKTNKKTYRKMNAYGNDHDRETWYDLLQIIAEEFEKI*
Ga0099391_100345143300006250HumanMKKLLFKLFFALAFASISLHGQEKIQQVEFSSFGGMALYSSQYTLNSLKKEFSAKPLMGQKEELPKEISLPNTPKNWEAFTKKINLDKFKKLRDGPSQQAFDGQDEVIIIKTDKKTYRKMNASGNDHDRKVWYDLLQIIAKEFGKKSIYE*
Ga0099392_12077313300006251HumanKARAILNFLSKILFKLFFTLAFASISLHGQEKIQQVEFSSFGGMALYSSRYTLNSLKKEFSAKPLMGQNEDLPKEISLPNTPKNWEAFTKKINLDKFKKLRDGPSQQAFDGQDEVIIIKTDKKTYRKMNASGNDHDRKVWYDLLQIIAKEFGKKSIYE*
Ga0099372_102016413300006253HumanMKKLLFKLFFTLAFASISLHGQEKIQQVEFISFGGMALYSSQYTLNSLKKEFSKKPLMGQKEELPKEISLPNTPKNWEAFTKKINLDKFKKLRDGPSQQTFDGQDEVIIIKTDKKTYRKMNASGNDHDREVWYDLLQIIAKEFGKKGVYE*
Ga0099353_1002379103300006255HumanMKKLLFKLFFTLAFASISLHGQEKIQQVEVHIFGGMALYSSRYTLNSLKKEFSAKPLMGQNEDLPKEISLPNTPKNWEAFTKKINLNKFKKLREGPSQQAFDGQDEVIIIKTDKKTYRKMNASGNDHDREVWYDLLQIIAKEFGKKGIYE*
Ga0099353_100237993300006255HumanMKKLLFKLFFALAFTSISLHGQEKIQQVEFSSFGGRALYSRQYTLNSLKKEFSKKPLMRQNKELPEEISLPNTPKNWEAFTKKINLNKFKELKDGPSQQASDGQDKVIIIKTDKKTYRKMNASGNDHDREVWYNLLQIIAKEFGKKGIYE*
Ga0099521_10472023300006261HumanMKKLLFKLFFALAFASISLHGQEKIQQVEVHIFGGMALYSSQYTLNSLKKEFNTKPLMGQKEELPKEISLPNTPKNWETFTKKINLDKFKKLRDGPSQQAFDGQDEVIIIKTDKKTYRKMNASGNDHDRKVWYDLLQIIAKEFGKKSIYE*
Ga0099657_100357103300006295HumanMKKLLFKLFFALAFASISLYGQEKIQQVEVHIFGGMALYSSQYTLNSLKKEFSKKPLMGQKEELPKEISLPNTPKNWEAFTKKINLNKFKELREGPSQQAFDGQDEVIIIKTNKKTYRKMNASGNDHDRETWYDLLQIIAKEFGKKSIYE*
Ga0099617_11326923300006301HumanMKKLLFKLFFALAFASISLHGQEKIQQVEFSSFGGMALYSSQYTLNSLKKEFSAKPLMGQKEELLKEVSLPNTPKNWEAFTKKINLDKFKELKDGPSEQAVDGRGQDKVIIIKTNKKTYRKMNAYGNDHDRETWYDLLQIIAEEFEKI*
Ga0099674_100251263300006317HumanMKKLLFKLFFALAFTSISLHGQEKIQQVEVHIFGGMALYSSHYTINFLYKEFEAKQVMGEPAELPKKILQLNPPDKWRVFTKKINLDKFKKLRDGPSEQAVDGQDEVIIIKTDKKTYRKMNAYGNDHDREVWYDLLQIIAKEFGKKGIYE*
Ga0099580_100136193300006328HumanMKKLLFKLFFALAFASISLHGQEKIQQVEVHIFGGMALYSSQYTLNSLKKEFSAKPLMGQKEELPKEISLPNTPKNWETFTKKINLDKFKKLRDGPSEQAFDGQDKVIIIKTDKKTYRKMNASGNDHDREVWYDLLQIIAKEFGKKGIYE*
Ga0100214_11271423300006457HumanMKKLLFKLFFTLAFASISLHGQEKIQQVEVHIFGGMALYSSYYTINFLYKEFEAKQVMGEPAELPKKILLLNPPDKWRVFTKKINLDRFKKLRNGPSEQAVDGQDEVIIIKTDKKTYRKMNASGNDHDREVWYDLLQIIAKEFGKKGIYE*
Ga0100222_100782143300006459HumanMKKLLFKLFFTLAFASISLHGQEKIQQVEFSSFGGMALYSSRYTLNSLKKEFSAKPLMGQNEDLPKEISLPNTPKNWEAFTKKINLDKFKKLRDGPSQQAFDGQDEVIIIKTDKKTYRKMNASGNDHDRKVWYDLLQIIAKEFGKKSIYE*
Ga0100060_100719133300006461HumanMKKLLFKLFFALAFTSISLHGQEKIQQVEVHIFGGMALYSSHYTINFLYKEFEAKQVMGEPAELPKKILQLNPPDKWRVFTKKINLDKFKKLRDGPSEQTVDGQDEVIIIKTDKKTYRKMNASGNDRDREVWYDLLQIIAKEFGKKGVYE*
Ga0100247_101087823300006479HumanMKKLLFKLFFALAFASISLHGQEKIQQVEVHIFGGMALYSSHYTINSLKKEFSAKPLMGQNEDLPKEISLPNTPKNWEAFTKKINLDKFKKLRDGPSQQAFDGQDEVIIIKTNKKTYRKMNAFGNDHDRETWYDLLQIIAKEFGKKSIYE*
Ga0100374_10357333300006498HumanMKKLLFKLFFALTLTSISLHGQEKIQQVEVHIFGGMALYSSHYTINFLYKEFEAKQVMGEPAELPKKILLLNPPDKWRVFTKKINLDRFKKLRDGPSEQAFDGQDEVIIIKTDKKTYRKMNASGNDHDREVWYDLLQIIAKEFGKKGIYE*
Ga0101805_11986513300006742HumanPHRQEKKQQVEVHIFGGMALYSSQYTLNSLKKEFSAKPLMGQKEELPKEISLPNTPKNWETFTKKINLNKFKKLRDGPSEQAFGGQDKVIIIKTNKKTYRKMNAYGNDHDRETWYDLLQIIAKEFGKKSIYE*
Ga0101797_1000418153300006744HumanKLFFALAFTSISLHGQEKIQQVEVHIFGGMALYSSHYTINFLYKEFEAKQVMGEPAELPKKILLLNPPDKWRVFTKKINLDKFKKLRDGPSEQAFDGQDEVIIIKTDKKTYRKMNASGNDHDREVWYDLLQIIAKEFGKKGIYE*
Ga0101797_101078943300006744HumanMKKLLFKLFFALAFVSISLHGQEKIQQVEFSSFGGRAVYSSRYTLNSLKKEFSAKPLMGQKEELPKEISLPNTPKNWEAFTKKINLNKFKELREGPSQQAFDGQDEVIIIKTNKKTYRKMNASGNDHDRETWYDLLQIIAKEFGKKSIYE*
Ga0101797_101078963300006744HumanFKLFFALAFASISLHGQEKIQQVEVHIFGGMALYSSQYTLNSLKKEFNTKPLMGQKEDLPKEISLPNTPKNWEAFTKKINLDKFKKLRDGPSQQAFDGQDEVIIIKTDKKTYRKMNASGNDHDREVWYDLLKIIAKEFGKKSIYE*
Ga0101799_10052533300006745HumanMKKLLFKLFFTLAFASISLHGQEKIQQVEVHIFGGMALYSSQYTLNSLKKEFSAKPLMGQKEELPKEISLPNTPKNWEAFTKKINLDKFKKLRDGPSQQAFDGQDEVIIIKTDKKTYRKMNASGNDHDRKVWYDLLQIIAKEFGKKSIYE*
Ga0103285_11182523300007066HumanMKKLLFKLFFALAFTSISLHGQEKILQVEFSSFKGMALYSRQYTLNSLKKEFSAKPLMGQKEELSKEVSLPNTPKNWEAFTKKINLDKFKKLRDCPSEQAFGGQDKVIIIKTNKKTYRKMNAYGNDHDRETWYDLLQIIAEEFEKI*
Ga0104058_10384923300007091HumanMKKLLFKLFFALAFASISLHGQEKIQQVEVHIFGGMALYSSHYTINSLKKEFSAKPLMGQNEDLPKEISLPNTPKNWEAFTKKINLDKFKKLRDGPSQQAFDGQDEVIIIKTDKKTYRKMNASGNDHDREVWYDLLQIIAKEFGKKGIYE*
Ga0104055_1000094133300007093HumanMKKLLFKLFFALAFASISLHGQEKIQQVEFSSFGGMALYSSRYTLNSLKKEFSAKPLMGQNKDLPKEISLPNTPKNWEAFTKKINLNKFKKLRDGPSQQAFDEHDEVIIIKTDKKTYRKMNTSGNDHDREVWYDLLQIIAKEFGKKSIYE*
Ga0102640_1000140203300007119HumanMKKLLFKLFFALALAFASISLHGQEKIQQVEFSSFGGRALYSSRYTLNSLKKEFSAKPLMGQNEDLPKEISLPNTPKNWEAFTKKINLNKFKKLRDGPSQQAFDGQDEVIIIKTNKKTYRKMNASGNDHDREVWYDLLQIIAKEFGKKSIYE*
Ga0102671_14337213300007121HumanMKKLLFKLFFALAFASISLHGQEKIQQVEFSSFGGMALYSRQYTLNSLKKEFSAKPLMGQKEELSKEVSLPNTPKNWETFTKKINLNKFKKLRDGPSEQAFGGQDKVIIIKTNKKTYRKMNAYGNDHDRETWYDLLQII
Ga0102717_100311103300007126HumanMKKLLFKLFFALAFASISLHGQEKIQQVEVHIFGGMALYSSQYTLNSLKKEFNTKPLMGQKEDLPKEISLPNTPKNWEAFTKKINLDKFKKLRDGPSQQAFDGQDEVIIIKTDKKTYRKMNASGNDHDREVWYDLLQIIAKEFGKKSIYE*
Ga0103275_12913723300007204HumanMKKLLFKLFFALTLTSISLHGQEKIQQVEVHIFGGMALYSSHYTINFLYKEFEAKQVMGEPAELPKKILLLNPPDKWRVFTKKINLDRFKKLKDSPSEQPVDGQDEVIIIKTDKKTYRKMNASGNDH
Ga0103291_12411713300007208HumanMKKLLFKLFFALAFVSISLHGQEKIQQVEFNSFGGMALYSSQYTLNSLKKEFSAKPLMGQKEELPKEISLPNTPKNWEAFTKKINLDKFKKLRDGPSQQAFDGQDEVIIIKTDKKTYRKMNASGNDHDRKVWYDLLQIIAKEFGKKGIYE*
Ga0104873_13029013300007287HumanDSYGATSPDKALSSRFKLTNPLVNFVLQTFNSFGGMALYSSQYTLNSLKKEFSAKPLMGQKEELPKEISLPNTPKNWEAFTKKINLDKFKKLKDGPSEQAVDGQDKVIIIKTNKKTYRKMNAYGNDHDRKVWYDLLQIIAKEFGKKSIYE*
Ga0104793_100030173300007297HumanMKKLLFKLFFALAFASISLHGQEKIQQVEVHIFGGMALYSSQYTLNSLKKEFSAKPLMGQKEELPKEISLPNTPKNWETFTKKINLDKFKKLRDGPSQQTFDGQDEVIIIKTDKKTYRKMNASGNDHDREVWYDLLQIIAKEFGKKSIYE*
Ga0104922_12725123300007316HumanMKKLLFKLFFALAFASISLHGQEKIQQVEVHIFGGMALYSSQYTLNSLKKEFSAKPLMGQNEDLPKEISLPNTPKNWEAFTKKINLDKFKKLRDGPSQQAFDGQDEVIIIKTDKKTYRKMNASGNDHDRKVWYDLLQIIAKEFGKKSIYE*
Ga0104967_100246203300007317HumanMKKLLFKLFFALAFTSISLHGQEKIQQVEVHIFGGMALYSSHYTINFLYKEFEAKQIMGEPAELPKKILQLNPPDKWRVFTKKINLDKFKKLRDGPSEQTVDGQDEVIIIKTDKKTYRKMNAYSSDHDREVWYDLLQIIAKEFGKKGIYE*
Ga0104967_100246223300007317HumanMKKLLFKLFFALAFTSISLHGQEKIQQVEFSSFGGRAVYSSRYTLNSLKKEFSTKPLMGQNEDLPKEISLPNTPKNWEAFTKKINLDKFKKLRDGPSQQAFDGQDEVIIIKTDKKTYRKMNASGNDHDRKVWYDLLQIIAKEFGKKSIYE*
Ga0104940_100188923300007320HumanMKKLLFKLFFALAFTSISLRGQEKIQQVEVHIFGGMALYSSHYTINFLYKEFEAKQVMGEPAELPKKILQLNPPDKWRVFTKKINLDKFKKLRDGPSEQTVDGQDEVIIIKTDKKTYRKMNAYSSDHDREVWYDLLQIIAKEFGKKGIYE*
Ga0104940_100398223300007320HumanMKKLLFKLFFALALAFASISLHGQEKIQQVEVHIFGGMALYSRQCTINSLKKEFSAKPLMGQKEELSKEISLPNTPKNWEAFTKKINLDKFKKLRDGPSQQAFDGQDEVIIIKTNKKTYRKMNAFGNDHDRETWYDLLQIIAKEFGKKSIYE*
Ga0104940_100398233300007320HumanMKKLLFKLFFALTLTSISLHGQEKIQQVEVHIFGGMALYSSHYTINFLYKEFEAKQVMGEPAELPKKISLPNTPKNWEAFTKKINLDKFKKLRDCPSEQAFGGQDKVIIIKTNKKTYRKMNAYGNDHDRETWYDLLQIIAEEFEKI*
Ga0104340_100167123300007347HumanMKKLLFKLFFALAFTSISLHGQEKIQQVEFSSFGGRALYSRLYTLNSLKKEFNTKPLMGQKEELSKEVSLPNTPKNWEVFIKKINLDKFKKLRDGPSEQAFGGQDKVIIIKTNKKTYRKMNAYGNDHDSETWYDLQQIIAKEFEKKGIYE*
Ga0104764_100461173300007357HumanMKKLLFKLFFALAFASISLHGQEKIQQVEVHIFGGMALYSSHYTINSLKKEFNTKPLMGQKEELPKEISLPNTPKNWEAFTKKINLDRFKKLRDGPSEQPVDGQDEVIIIKTDKKTYRKMNASSNDHDREVWYDLLQIIAKEFGKKGIYE*
Ga0104977_104339123300007368HumanLLFKLFFALAFASISLHGQEKIQQVEVHIFGGMALYSSHYTINFLYKEFEAKQVMGEPTELPKKILLLNPPDKWRFFIKKINLDKFKKLRDGPSEQAVDGQDEVIIIKTDKKTYRKMNAYGNDHDRETWYGLLQIIAEEFGKKGIYE*
Ga0104983_1000191343300007500HumanMKKLLFKLFFTLAFASISLHGQEKIQQVEVHIFGGMALYSSQYTLNSLKKEFNTKPLMGQKEELPKEISLPNTPKNWEAFTKKINLDKFKKLRDGPSQQAFDGQDEVIIIKTDKKTYRKMNASGNDHDREVWYDLLKIITKEFGKKSIYE*
Ga0104983_14124613300007500HumanMKKLLFKLFFALTLTSISLHGQEKIQQVEVHIFGGMALYSSHYTINFLYKEFEAKQVMGEPAELPKKILLLNPPDKWRVFTKKINLDRFKKLRDGPSEQAVDGQDEVIIIKTDKKTYRKMNAYGNDHDREVWYDLLQIIAKEFGKKGIYE*
Ga0105502_1000098733300007531HumanMKKLLFKLFFTLAFASISLHGQEKIQQVEFSSFGGMALYSSQYTLNSLKKEFSAKPLMGQKEDLPKEISLPNTPKNWEAFTKKINLDKFKKLKDGPSEQAFDGQDEVIIIKTDKKTYRKMNASGNDHDREVWYDLLQIIAKEFGKKGVYE*
Ga0104970_101758423300007566HumanMKKLLFKLFFALAFASISLHGQEKIQQVEVHIFGGMALYSSQYTLNSLKKEFSAKPLMGQKEELPKEISLPNTPKNWEAFTKKINLDKFKKLRDGPSQQAFDGQDEVIIIKTDKKTYRKMNASGNDHDRKVWYDLLQIIAKEFGKKSIYE*
Ga0105526_100397563300007638HumanMKKLLFKLFFTLAFTSISLHGQEKIQQVEVHIFGGMALYSSQYTLNSLKKEFSAKPLMGQKEELPKEISLPNMPKNWEAFTKKINLDKFKKLRDGPSQQAFDGQDEVIIIKTNKKTYRKMNASGNDHDREVWYDLLQIIAKEFGKKSIYE
Ga0105526_102204133300007638HumanMKKLLFKLFFALAFTSISLHGQEKIQQVEVHIFGGMALYSSHYTINFLYKEFEAKQVMGEPAELPKKILLLNPPDKWRVFTKKINLDRFKKLRDGPSEQPVDGQDEVIIIKTDKKTYRKMNASGNDHDREVWYDLLQIIAKEFGKKSIYE
Ga0105530_1000605103300007646HumanMKKLLFKLFFALAFTSISLRGQEKIQQVEVHIFGGMALYSSHYTINFLYKEFEAKQVMGEPAELPKKILQLNPPDKWRVFTKKINLDRFKKLRDGPSEQPVDGQDEVIIIKTDKKTYRKMNASGNDHDREVWYDLLQIIAKEFGKKGIYE*
Ga0105530_100060583300007646HumanMKKLLFKLFFTLAFASISLHGQEKIQQVEVHIFGGMALYSSRYTLNSLKKEFSAKPLMGQNEDLPKEISLSNTPKNWEAFTKKINLNKFKKLRDGPSQQAFDGQDEVIIIKTDKKTYRKMNATGNDHDREVWYDLLQIIAKEFGKKSIYE*
Ga0105543_100562863300007666HumanMKKLLFKLFFALAFTSIPLHGQEKIQQVEVHIFGGMALYSSHYTINFLYKEFEAKQVMGEPAELPKKILLLNPPDKWRVFTKKINLDKFKKLRDGPSEQTVDGQDEVIIIKTDKKTYRKMNAYGNDHDRETWYDLLQIIAEEFEKI*
Ga0105642_100444423300007711HumanMKKLLFKLFFTLAFASISLHGQEKIQQVEVHIFGGMALYSSQYTLNSLKKEFSAKPLMGQNEDLPKEISLPNTPKNWEAFTKKINLDKFKKLRDGPSQQAFDGQDEVIIIKTDKKTYRKMNASGNDHDRKVWYDLLQIIAKEFGKKSIYE*
Ga0105756_10040223300007732HumanMKKLLFKLFFALAFTSISLHGQEKIQQVEFSSFGGMALYSRQYTFNSLKKEFSAKPLMGQKEELSKEVSLPNTPKNWEAFTKKINLNKFKKLRDGPSEQAFGGQDKVIIIKTNKKTYRKMNAYGNDHDRETWYDLLQIIAEEFEKI*
Ga0105756_10040233300007732HumanMKKLLFKLFFALAFASISLHGQEKIQQVEVHIFGGMALYSSQYTLNSLKKEFSKKLLMRQNKDLPEEISLPNTTENWEAFTKKINLDKFKKLRDGPSEQAFGGQDKVIIIKTDKKTYRKMNASGNDHDRKVWYDLLQIITKEFGKKGIYE*
Ga0105756_100756203300007732HumanMKKLLFKLFFALAFTSISLHGQEKIQQVEVHIFGGMALYSSHYTINFLYKEFEAKQVMGEPAELPKKILLLNPPDKWRVFTKKINLDKFKKLRDGASEQAFDGQDEVIIIKTDKKTYRKMNASGNDHDREVWYDLLQIIAKEFGKKGIYE*
Ga0105757_100682853300007736HumanMKKLLFKLFFALAFASISLHGQEKIQQVEVHIFGGMALYSSQYTLNSLKKEFSAKPLMGQKEELPKEISLPNTPKNWEAFTKKINLNKFKELKDGPSQQAFDGQDEVIIIKTDKKTYRKMNASGNDHDREVWYDLLQIIAKEFGKKGIYE*
Ga0105776_103174313300007746HumanMKKLLFKLFFTLAFASISLHGQEKIQQVEVHIFGGMALYSSRYTLNSLKKEFSAKPLMGQNEDLPKEISLSNTPKNWEAFTKKINLNKFKKLRDGPSQQAFDGQDEVIIIKTDKKTYRKMNASGNDHDRKVWYDLLQIITKEFGKKGIYE*
Ga0105806_100402013300007791HumanMKKLLFKLFFALAFASISLHGQEKIQQVEFSSFGGMALYSSRYTLNSLKKEFSAKPLMGQKEELLKEVSLPNTPKNWEAFTKKINLNKFKKLKDGPSQQAFDGQDKVIIIKTDKKTYRKMNASGNDHDREVWYDLLKIITKEFGKKSIYE*
Ga0105806_100402023300007791HumanMKKLLFKLFFALAFASISLHGQEKIQQVEVHIFGGMALYSSHYTINFLYKEFEAKQVMGEPAELPKKILQLNPPDKWRVFTKKINLDKFKKLRDGPSEQAVDGQDEVIIIKTDKKTYRKMNAYGNDHDREVWYDLLQIIAKEFGKKSIYE*
Ga0113553_100356163300007925HumanMKKLLFKLFFALTLTSISLHGQEKIQQVEVHIFGGMALYSSHYTINFLYKEFEAKQVMGEPAELPKKILLLNPPDKWRVFTKKINLDKFKKLRDGASEQAFDGQDEVIIIKTDKKTYRKMNASGNDHDREVWYDLLQIIAKEFGKKGIYE*
Ga0113553_100356183300007925HumanMKKLLFKLFFALAFTSISLHGQEKIQQVEFSSFGGMALYSRQYTFNSLKKEFSAKPLMGQKEELPKEVSLPNTPKNWEAFTKKINLNKFKKLRDGPSEQAFGGQDKVIIIKTNKKTYRKMNAYGNDHDMETWYDLLQIIAEEFEKI*
Ga0113866_12152313300007926HumanNHRKRIWEEKYLRINYFMKKLLFKLFFALAFASISLHGQEKIQQVEVHIFGGMALYSSQYTLNSLKKEFSAKPLMGQNEDLPKEISLPNTPKNWEAFTKKINLNKFKKLRDGLSKQEFDGQDKVIIIKTDKKTYRKMNASGNDHDREVWYDLLKIIAKEFGKKSIYE*
Ga0114257_100156443300007940HumanMKKLLFKLFFALAFASISLHGQEKIQQVEFNSFGGMALYSSQYTLNSLKKEFSAKPLMGQNEDLPKEISLPNTPKNWEAFTKKINLNKFKKLREGPSQQAFDGQDEVIIIKTDKKTYRKMNASGNDHDREVWYDLLKIIAKEFGKKGIYE*
Ga0105969_100194143300007968HumanMKKLLFKLFFTLAFASISLHGQEKIQQVEFSSFGGMALYSRQYTFNSLKKEFSAKPLMGQKEELSKEVSLPNTPKNWEAFTKKINLNKFKKLRDGPSEQAFGGQDKVIIIKTNKKTYRKMNAYGNDHDMETWYDLLQIIAEEFEKI*
Ga0114366_105586813300007980HumanMKKLLFKLFFALAFASISLHGQEKIQQVEVHIFGGMALYSSHYTINFLYKEFEAKQVMGEPAELPKKILLLNPPDKWRVFTKKINLDKFKKLRDGPSEQPVDGQDEVIIIKTDKKTYRKMNASGNDHDRETWYDLLQIIAEE
Ga0111053_1000151043300007997HumanMKKLLFKLFFALAFTSISLHGQERIQQVEFSSFGGMALYSRQYTLNSLKKEFSKKLLMRQNKDLPEEISLPNTPENWEAFTKKINLDKFKKLKDGPSEQAVDGQDKVIIIKTNKKTYRKMNASGNDHDRETWYDLLQIIAKEFGKKSIYE*
Ga0111053_1000151053300007997HumanMKKLLFKLFFALAFTSISLHGQEKIQQVEVHIFGGMALYSSHYTINFLYKEFEAKQVMGEPAELPKKILLLNPPDKWRVFTKKINLDKFKKLRDGPSEQAVDGQDEVIIIKTDKKTYRKMNASGNDHDREVWYDLLQIIAKEFGKKGIYE*
Ga0114851_105335213300008073HumanMKKLLFKLFFALAFTSISLHGQEKIQQVEFSSFGGMALYSRQYTFNSLKKEFSAKPLMGQKEELSKEVSLPNTPKNWEAFTKKINLNKFKKLRDGPSEQAFGGQDKVIIIKTNKKTYRKMNAYGNDHDRETWYDLLQIIA
Ga0114853_100565123300008075HumanMKKLLFKLFFALAFASISLHGQEKIQQVEVHIFGGMALYSSHYTINFLYKEFEAKQVMGEPAELPKKILLLNPPDKWRVFTKKINLDKFKKLRDGPSEQPVDGQDEVIIIKTDKKTYRKMNASGNDHDREVWYDLLQIIAKEFGKKGIYE*
Ga0114853_100565133300008075HumanMKKLLFKLFFALAFTSISLHGQEKIQQVEVHIFGGMALYSRQYTLNSLKKEFSAKPLMGQKEELSKEVSLPNTPKNWEAFTKKINLDKFKELKDGPSEQAFGGQDKVIIIKTNKKTYRKMNAYGNDHDRETWYDLLQIIAEEFEKI*
Ga0105968_101112313300008082HumanMKKLLFKLFFALAFTSISLHGQEKIQQVEFSSFGGRAVYSSRYTLNSLKKEFSAKPLMGQKEELPKEISLPNTPENWEAFTKKINLNKFKELKDGPSQQAFDGQDKVIIIKTDKKTYRKINAYGNNHDREVWYDLLQIIAKEFGKKSIYE*
Ga0105970_1000031073300008083HumanMKKLLFKLFFTLAFASISLHGQEKIQQVEFSSFGGIALYSERYTLNSLKKEFSAKPLMEQNKDLPKEISLPNTPKNWEAFTKKINLNKFKKLRDGPSQQAFDGQDEVIIIKTDKKTYRKMNASGNDHDRKVWYDLLQIITKEFGKKGIYE*
Ga0105970_1000031083300008083HumanMKKLLFKLFFALAFTSISLHGQEKIQQVEFSSFGGMALYSRQYTFNSLKKEFSAKPLMGQKEELSKEVSLPNTPKNWEAFTKKINLNKFKKLRDGPSEQAFGGQDKVIIIKTNKKTYRKMNAYGNDHDMETWYDLLQIIAEEFEKI*
Ga0104978_101649623300008089HumanMKKLLFKLFFTLAFASISLHGQEKIQQVEVHIFGGMALYSSRYTLNSLKKEFSAKPLMGQKEELPKEISLSNTPKNWEAFTKKINLNKFKKLREGPSEQAVDGQDEVIIIKTDKKTYRKMNASGNDHDRETWYDLLQIIAKEFGKKGVYE*
Ga0114249_1000156213300008102HumanMKKLLFKLFFALAFTSISLHGQEKIQQVEFSSFGGRAVYSSRYTLNSLKKEFSAKPLMGQKEELPKEISLPNTPKNWEAFTKKINLDKFKKLRDGPSQQDFDGQDEVIIIKTDKKTYRKMNARGNDHDREVWYSLLQIIAKEFGKKSIYE*
Ga0114249_103775023300008102HumanMKKLLFKLFFALAFASISLHGQEKIQQVEVHIFGGMALYSSHYTINFLYKEFEAKQVMGEPAELPKKILLLNPPDKWRVFTKKINLDKFKKLRDGPSEQAVDGQDEVIIIKTDKKTYRKMNAYSNDHDREVWYDLLQIIAKEFGKKGIYE*
Ga0111365_12919613300008133HumanMKKLLFKLFFALAFASISLHGQEKIQQVEVHIFGGMALYSSQYTLNSLKKEFSAKPLMGQKEELPKEISLPNTPKNWEAFTKKINLDKFKKLRDGPSEQAFDGQDKVIIIKTDKKTYRKMNASGNDHDREVWYDLLQIIPKEFGKKGVYE*
Ga0114165_100197243300008140HumanMKKLLFKLFFALALTSISLHGQEKIQQVEVHIFGGMALYSSHYTINFLYKEFEAKQVMGEPAELPKKILQLNPPDKWRVFTKKINLDRFKKLRDGPSEQPVDGQDEVIIIKTDKKTYRKMNASGNDHDREVWYDLLQIIAKEFGKKGIYE*
Ga0114165_100197263300008140HumanMKKLLFKLFFALAFASISLHGQEKIQQVEVHIFGGMALYSSRYTLNSLKKEFSAKPLMGQNKDLPKEISLPNTPKNWEAFTKKINLDKFKKLRDGPSEQAVDGQDAVIIIKTDKKTYRKMNASGNDHDREVWYGLLQIIAKEFGKKGVYE*
Ga0114286_104039823300008142HumanMKKLLFKLFFALAFASISLHGQEKIQQVEVHIFGGMALYSSHYTINFLYKEFEAKQVMGEPAELPKKILLLNPPDKWRVFTKKINLDRFKKLRNGPSEQAVDGQDEVIIIKTDKKTYRKMNAYSNDHDREVWYDLLQIIAKEFGKKGVYE*
Ga0114284_100083843300008144HumanMKKLLFKLFFALAFTSISLHGQEKIQQVEVHIFGGMALYSRQYTLNSLKKEFSAKPLMGQKEELPKEISLPNTPKNWEAFTKKINLDKFKKLRDGPSQQAFDEHDEIIIIKTDKKTYRKMNASGNDHDREVWYDLLQIIAKEFGKKSIYE*
Ga0114367_11372533300008147HumanMKKLLFKLFFALAFASISLHGQEKIQQVEFNSFGGMALYSSQYTLNSLKKEFSAKPLMGQKEELPKEISLPNTPKNWETFTKKINLNKFKKLRDGPSEQAFGGQDKVIIIKTNKKTYRKMNASGNDHDREVWYDLLQIIAEEFGKKGVYE*
Ga0114285_101304723300008152HumanMKKLLFKLFFALAFASISLHGQEKIQQVEVHIFGGMALYSSQYTLNSLKKEFSAKPLMGQKEELPKEISLPNTPKNWETFTKKINLNKFKKLRDGPSEQAFGGQDKVIIIKTNKKTYRKMNAYGNDHDRETWYDLLQIIAEEFEKI*
Ga0114285_101304743300008152HumanMKKLLFKLFFALALAFASISLHGQEKIQQVEVHIFGGMALYSSHYTINFLYKEFEAKQVMGEPAELPKKILLLNPPDKWRVFTKKINLDRFKKLRDGPSEQPVDGQDEVIIIKTDKKTYRKMNASGNDHDREVWYDLLQIIAKEFGKKGIYE*
Ga0114019_1001552113300008159HumanMKKLLFKLFFALAFTSISLHGQEKIQQVEFSGFGGRVLYSSRYTLNSLKKEFSAKPLMGQKEDLPKEISLPNTPKNWEAFTKKINLNKFKKLRDGPSQQAFDEHDEIIIIKTDKKTYRKMNASGNDHDREVWYDLLQIIAKEFGKKSIYE*
Ga0114019_104003023300008159HumanMKKLLFKLFFALAFTSISLRGQEKIQQVEVHIFGGMALYSSHYTINFLYKEFEAKQVMGEPAELPKKILQLNPPDKWRVFTKKINLDKFKKLRDGPSEQTVDGQDEVIIIKTDKKTYRKMNAYSNDHDREVWYDLLQIIAKEFGKKGIYE*
Ga0114158_100007023300008160HumanMKKLLFKLFFALTLTSISLHGQEKIQQVEVHIFGGMALYSSHYTINFLYKEFEAKQVMGEPAELPKKILQLNPPDKWRVFTKKINLDKFKKLRDGPSEQTVDGQDEVIIIKTDKKTYRKMNASGNDRDREVWYDLLQIIAKEFGKKGVYE*
Ga0111085_11668223300008271HumanMKKLLFKLFFALAFTSISLHGQEKIQQVEFSSFGGILYSSRYTLNSLKKEFSAKPLMGQNEDLPKEISLPNTPKNWEAFTKKINLNKFKKLRDGPSQQAFDEHDEVIIIKTDKKTYRKMNTSGNDHDRETWYDLLQIITEEFEKI*
Ga0111085_11668233300008271HumanMKKLLFKLFFALAFASISLHGQEKIQQVEFSSFGGMALYSSRYTLNSLKKEFSAKPLMGQNKDLPKEISLPNTPKNWEAFTKKINLDKFKKLRDGPSEQAVDGQDAVIIIKTDKKTYRKMNASGNDHDREVWYGLLQIIAKEFGKKGVYE*
Ga0115372_100061273300008334HumanMKKLLFKLFFALAFASISLHGQEKIQQVEFSSFGGRAVYSERYTLNSLKKEFSAKPLMGQNEDLPKEISLPNTPKNWEAFTKKINLNKFKKLREGPSQQAFDGQDEVIIIKTNKKTYRKMNASGNDHDREVWYDLLQIIAKEFGKKSIYE*
Ga0115372_100061283300008334HumanMKKLLFKLFFALAFTSISLHGQEKIQQVEVHIFGGMALYSSHYTINFLYKEFEAKQVMGEPAELPKKILLLNPPDKWRFFIKKINLDKFKKLRDGPSEQAVDGQDEVIIIKTDKKTYRKMNASGNDHDRETWYGLLQIIAKEFGKKGIYE*
Ga0115381_1000231003300008341HumanMKKLLFKLFFALAFTSISLHGQEKIQQVEFISFKGMALYSRQYTLNSLKKEFSAKPLMGQNEELSKEVSLPNTPKNWEAFTKKINLDKFKKLRDCPSEQAFGGQDKVIIIKTNKKTYRKMNAYGNDHDRETWYDLLQIIAEEFEKI*
Ga0115381_1000231023300008341HumanMKKLLFKLFFALTFTSISLHGQEKIQQVEVHIFGGMALYSSHYTINFLYKEFEAKQVMGEPAELPKKILLLNPPDKWRVFTKKINLDKFKKLRDGPSEQAFDGQDEVIIIKTDKKTYRKMNASGNDHDRKVWYDLLQIIAKEFGKKGIYE*
Ga0115411_1000018813300008347HumanMKKLLFKLFFTLAFASISLHGQEKIQQVEVHIFGGMALYSSQYTLNSLKKEFSAKPLMGQKEELSKEVSLPNTPKNWETFTKKINLDKFKKLRDGPSQQAVDGQDEVIIIKTDKKTYRKMNASGNDHDREVWYDLLQIIAKEFGKKGIYE*
Ga0115412_10139343300008348HumanMKKLLFKLFFALAFASISLHGQEKIQQVEVHIFGGMALYSSHYTINFLYKEFEAKQVMGEPAELPKKILQLNPPDKWRVFTKKINLDKFKKLRDGPSEQAVDGQDEVIIIKTDKKTYRKMNAYGNDHDREVWYDLLQIIAEEFGKKGIYE*
Ga0115180_10767143300008363HumanASISLHGQEKIQQVEVHIFGGMALYSSHYTINSLKKEFSAKPLMGQNEDLPKEISLPNTPKNWEAFTKKINLDKFKKLRDGPSQQAFDGQDEVIIIKTNKKTYRKMNAFGNDHDRETWYDLLQIIAKEFGKKSIYE*
Ga0115182_12915113300008403HumanEVHIFGGMALYSSHYTINSLKKEFSAKPLMGQNEDLPKEISLPNTPKNWEAFTKKINLDKFKKLRDGPSQQAFDGQDEVIIIKTNKKTYRKMNAFGNDHDRETWYDLLQIIAKEFGKKSIYE*
Ga0115224_1000004953300008406HumanMKKLLFKLFFALAFVSISLHGQEKIQQVEVHIFGGMALYSSRYTLNSLKKEFSAKPLMGQKEELPKEISLPNTPKNWEAFTKKINLDKFKKLRDGPSQQTFDGQDEVIIIKTDKKTYRKMNASGNDHDRKVWYDLLQIIAKEFGKKSIYE*
Ga0115077_10200383300008408HumanMKKLLFKLFFTLAFASISLHGQEKIQQVEVHIFGGMALYSSQYTLNSLKKKFSAKPLMGQKEELPKEISLPNTPKNWETFTKKINLDKFKKLRDGPSQQAVDGQDEVIIIKTDKKTYRKMNASGNDHDRKVWYDLLQIIAKEFGKKSIYE*
Ga0115173_1002036123300008480HumanMKKLLFKLFFALAFTSISLHGQEKIQQVEVHIFGGMALYSSHYTINFLYKEFEAKQVMGEPAELPKKILLLNPPDKWRVFTKKINLDKFKKLRDGPSEQAVDGQDEVIIIKTDKKTYRKMNAYGNDHDREVWYDLLQIIAKEFGKKGIYE*
Ga0115173_1002036153300008480HumanMKKLLFKLFFALAFASISLHGQEKIQQVEFISFGGRALYSRQYTLNSLKKEFSKKPLMGQNEDLPKEISLPNTPKNWEAFTKKINLNKFKKLRDGPSQQAFDGQDEVIIIKTDKKTYRKMNASGNDHDREVWYDLLQIIAKEFGKKSIYE*
Ga0115177_100222013300008481HumanMKKLLFKLFFALAFTSISLHGQEKIQQVEFISFKGMALYSRQYTLNSLKKEFSAKPLMGQNEDLPKEISLPNTPKNWEAFTKKINLNKFKKLRDCPSEQAFGGQDKVIIIKTNKKTYRKMNAYGNDHDRETWYDLLQIIAEEFEKI*
Ga0115177_100222023300008481HumanMKKLLFKLFFALAFASISLHGQEKIQQVEVHIFGGMALYSSHYTINFLYKKFEAKQVMGEPAELPKKILLLNPPDKWRVFTKKINLDRFKKLRDGPSEQAFDGQDEVIIIKTDKKIYRKMNASGNDHDREVWYDLLQIIAKEFGKKSIYE*
Ga0115196_102758623300008486HumanMKKLLFKLFFALAFASISLHGQEKIQQVEFSSFGGMALYSRQYTLNSLKKEFSKKTLMEQNKELPEEISLPNTTENWEAFTKKINLNKFKKLRDGPSEQAFGGQDXXXXFGGQDKVIIIKTNKKTYRKMNAYSNDHDREVWSDLLQIIAKEFGKKAFMSK*
Ga0115196_104885913300008486HumanMKKLLFKLFFALAFTSISLHGQEKIQQVEFSSFGGRAVYSSRYTLNSLKKEFSTKPLMGQNEDLPKEISLPNTPKNWEAFTKKINLNKFKELREGPSQQAFDGQDEVIIIKTNKKTYRKMNASGNDHDRET
Ga0114893_11093823300008495HumanMKKSLFKLFFALAFASISLHGQEKIQQVEFNSFGGMALYSSQYTLNSLKKEFSAKPLMGQNEDLPKEISLPNTPKNWEAFTKKINLNKFKKLREGPSQQAFDGQDEVIIIKTDKKTYRKMNASGNDHDREVWYDLLKIIAKEFGKKGIYE*
Ga0111014_10089123300008505HumanMKKLLFKLFFALAFASIPLHGQEKIQQVEFSSFGGRALYSSRYTLNSLKKEFSAKPLMGQNEDLPKEISLPNTPKNWEAFTKKINLNKFKKLRDGPSQQAFDGQDEVIIIKTNKKTYRKMNASGNDHDRKVWYDLLQIIAEEFGKKGIYE*
Ga0115176_102635333300008506HumanMKKLLFKLFFALAFTSISLHGQEKILQVEFSSFGGMALYSRQYTLNSLKKEFSAKPLMGQKEELSKEVSLPNTPKNWETFTKKINLNKFKKLRDGPSEQAFGGQDKVIIIKTNKKTYRKMNAYGNDHDRETWYDLQQIIAEEIWKKRRL*
Ga0115176_104352923300008506HumanMKKLLFKLFFALAFASISLHGQEKIQQVEVHIFGGMALYSSQYTLNSLKKEFNTKPLMGQKEDLPKEISLPNTPKNWEVFTKKINLDKFKGLKDGPSQQAFDGQDEVIIIKTDKKTYRKMNASGNDHDREVWYDLLQIIAKEFGKKGVYE*
Ga0115191_100756123300008518HumanMKKLLFKLFFALAFASISLHGQEKIQQVEVHIFGGMALYSSQYTLNSLKKEFSAKPLMGQKEELPKEISLPNTPKNWEAFTKKINLDKFKKLRDGPSQQAFDGQDEVIIIKTDKKTYRKMNASGNDHDREAWYNLLQIIAKEFGKKSIYE*
Ga0111059_10057793300008556HumanMKKLLFKLFFALAFTSISLHGQEKIQQVEFSSFGGRVLYSRQYTLNSLKKEFSKKPLMRQNKELPEEISLPNTPKNWEAFTKKINLDKFKKLKDGPSEQAVDGQDKVIIIKTDKKTYRKMNASGNDHDREVWYDLLQIIAKEFGKKGVYE*
Ga0111079_10328863300008575HumanMKKLLFKLFFALAFASISLHGQEKIQQVEVHIFGGMALYSSQYTLNSLKKEFNTKPLMGQKEELPKEISLPNTPKNWEAFTKKINLNKFKKLRDGPSQQAFDGQDEVIIIKTDKKTYRKMNASGNDHDREVWYDLLQIIVKEFGKKSIYE*
Ga0111366_10141513300008628HumanQTAFIMKKLLFKLFFTLAFASISLHGQEKIQQVEVHIFGGMALYSSQYTLNSLKKEFSAKPLMGQKEELPKEISLPNTPKNWEAFTKKINLDKFKKLRDGPSQQAFDGQDEVIIIKTDKKTYRKMNASGNDHDRKVWYDLLQIIAKEFGKKSIYE*
Ga0111369_100111273300008634HumanMKKLLFKLFFALAFASISLHGQEKIQQVEVHIFGGMALYSSQYTLNSLKKEFSAKPLMGQKEELSKEISLPNTPKNWEAFTKKINLNKFKELRDGPSEQAFGGHDKVIIIKTDKKTYRKMNAYGNDHDRETWYDLLQIITEEFEKI*
Ga0111369_100111283300008634HumanMKKLLFKLFFALTFASISLHGQEKIQQVEFSSFGGRAVYSSRYTLNSLKKEFSKKPLMGQKEELPKEISLPNTPKNWEAFTKKINLNKFKKLREGPCQQAFDGQDEVIIIKTDKKTYRKMNASGNDHDREVWYDLLKIIAKEFGKKSIYE*
Ga0115679_100042823300008635HumanMKKLLFKLFFALAFVSISLHGQEKIQQVEFSSFGGRAVYSSQYTLNSLKKEFSKKPLMGQKEELPKEISLPNTPKNWEAFTKKINLNKFKELREGPSQQAFDGQDEVIIIKTNKKTYRKMNASGNDHDRETWYDLLQIIAKEFGKKSIYE*
Ga0115685_100377433300008639HumanMKKLLFKLFFALAFASISLHGQEKIQQVEIHIFGGMALYSSRYTLNSLKKEFSAKPLMGQNEDLPKEISLPNTPKNWEAFTKKINLDKFKKLRDGPSQQAFDGQDEVIIIKTDKKTYRKMNASGNDHDRKVWYDLLQIIAKEFGKKSIYE*
Ga0111425_10428553300008645HumanMKKLLFKLFFTLAFASISLHGQEKIQQVEVHIFGGMALYSSRYTLNSLKKEFSAKPLMGQNKDLPKEISLPNTPKNWEAFTKKINLDKFKKLRDGPSEQAVDGQDAVIIIKTDKKTYRKMNASGNDHDREVWYGLLQIIAKEFGKKGVYE*
Ga0111425_10448333300008645HumanMKKLLFKLFFALAFTSISLHGQEKIQQVEFSSFGGRAVYSSRYTLNSLKKEFSTKPLMGQNEDLPKEISLPNTPKNWEAFTKKINLNKFKELREGPSQQAFDGQDEVIIIKTNKKTYRKMNASGNDHDRETWYDLLQIITKEFGKKGIYE*
Ga0111425_10448353300008645HumanMKKLLFKLFFALAFTSISLHGQEKIQQVEVHIFGGMALYSSHYTINFLYKEFEAKQVMGEPAELPKKILQLNPPDKWRVFTKKINLDKFKKLRDGPSEQTVDGQDEVIIIKTDKKTYRKMNASGNDHDREVWYDLLQIIAKEFGKKGIYE*
Ga0111455_101696713300008650HumanGQEKIQQVEVHIFGGIALYSSHYTINFLYKEFEAKQVMGEPAELPKKILLLNPPDKWRVFTKKINLDRFKKLKDSPSEQPVDGQDEVIIIKTDKKTYRKMNASGNDHDREVWYNLLQIIAREFGKKGIYE*
Ga0115430_100914713300008679HumanMKKLLFKLFFTLAFASISLHGQEKIQQVEVHIFGGMALYSSQYTLNSLKKEFSAKPLMGQKEELSKEISLPNTPKNWEAFTKKINLNKFKELRDGPSEQAFGGHDKVIIIKTDKKTYRKMNASGN
Ga0115430_106237623300008679HumanMKKLLFKLFFALTLTSISLHGQEKIQQVEVHIFGGMALYSSHYTINFLYKEFEAKQVMGEPAELPKKILLLNPPDKWRVFTKKINLDRFKKLRDGPSEQAFDGQDEVIIIKTDKKTYRKMNASGND
Ga0111555_1000429303300008680HumanMKKLLFKLFFALAFTSISLHGQERIQQVEFSSFGGMALYSRQYTLNSLKKEFSKKPLMEQNKELPEEISLPNTPENWEAFTKKINLNKFKKLREGPSQQAFDGQDEVIIIKTNKKTYRKMNASGNDHDREVWYDLLQIIAKEFGKKSIYE*
Ga0113557_100065753300008695HumanMKKLLFKLFFALAFTSISLHGQEKIQQVEFSSFGGMALYSRQYTLNSLKKEFSKKLLMRQNKDLPEEISLPNTPENWEAFTKKINLDKFKKLKDGPSEQAVDGQDKVIIIKTNKKTYRKMNASGNDHDRETWYDLLQIIAKEFGKKSIYE*
Ga0113865_11949113300008700HumanMKKLLFKLFFALAFVSISLHGQEKIQQVEFSSFGGRAVYSSRYTLNSLKKEFSAKPLMGQKEDLPKEISLPNTPKNWEAFTKKINLNKFKKLREGPSQQAFDGQDEVIIIKTNKKTYRKMNASGNDHDRETWYDLLQIIAKEFGKKSIYE*
Ga0113885_100239203300008729HumanMKKLLFKLFFALAFASISLHGQEKIQQVEVHIFGGMALYSSQYTLNSLKKEFSAKPLMGQKEELPKEISLPNTPKNWEAFTKKINLNKFKKLRDGPSEQAVDGQDEVIIIKTDKKTYRKMNASGNDHDREVWYDLLQIIAKEFGKKGIYE*
Ga0114022_100003723300008743HumanMKKLLFKLFFALAFTSISLHGQEKIQQVEVHIFGGMALYSSHYTINFLYKEFEAKQVMGEPAELPKKILLLNPPDKWRVFTKKINLDRFKKLRDGPSEQPVDGQDEVIIIKTDKKTYRKMNASGNDHDREVWYDLLQIIAKEFGKKSIYE*
Ga0114022_1000895193300008743HumanMKKLLFKLFFTLAFTSISLHGQEKIQQVEVHIFGGMALYSSQYTLNSLKKEFSAKPLMGQKEELPKEISLPNMPKNWEAFTKKINLDKFKKLRDGPSQQAFDGQDEVIIIKTNKKTYRKMNASGNDHDREVWYNLLQIIAKEFGKKSIYE*
Ga0114084_103494013300008746HumanMKKLLFKLFFTLAFASISLHGQEKIQQVEVHIFGGMALYSSQYTLNSLKKEFSAKPLMGQKEELPKEISLPNMPKNWEAFTKKINLNKFKKLRDGPSEQAFGGQDKVIIIKTNKKTYRKMNAYGNDHDRETWYDLLQIITKEFGKKSIYE*
Ga0115223_100567733300009363HumanMKKLLFKLFFALAFTSISLHGQEKIQQVEVHIFGGMALYSSQYTLNSLKKEFSAKPLMGQKEELPKEISLPNTPKNWEAFTKKINLNKFKKLKDGPSQQAFDGQDKVIIIKTDKKTYRKMNASGNDHDREVWYDLLQIIAKEFGKKGIYE*
Ga0111010_100695043300009393HumanMKKLLFKLFFALAFASISLHGQEKIQQVEVHIFGGMALYSSHYTINFLYKEFEAKQVMGEPAELPKKILLLNPPDKWRVFTKKINLDRFKKLRDGPSEQAVDGQDEVIIIKTDKKTYRKMNASGNDHDREVWYDLLQIIAKEVRSKGIYE*
Ga0111010_104845033300009393HumanAFTSISLHGQEKIQQVEVHIFGGRALYSSRYTLNSLKKEFSTKPLMGQNEDLPKEISLPNTPKNWEAFTKKINLNKFKKLRDGPSQQAFDGEDEVIIIKTDKKTYRKMNASGNDHDRKVWYDLLQIIAKEFGKKSIYE*
Ga0119804_1000021003300011914Human OralMKKLLFKLFFTLAFASISLHGQEKIQQVEFSSFGGRAVYSERYTLNSLKKEFSAKPLMGQKEELPKEISLPNTPKNWEAFTKKINLNKFKKLREGPSQQAFDGQDEVIIIKTNKKTYRKMNASGNDHDREVWYDLLQIIAKEFGKKSIYE*
Ga0119804_1000021013300011914Human OralMKKLLFKLFFALVFASISLHGQEKIQQVEVHIFGGMALYSSHYTINFLYKEFEAKQVMGEPAELPKKILQLNPPDKWRVFTKKINLDKFKKLRDGPSEQAVDGQDEVIIIKTDKKTYRKMNAYGNDHDREVWYDLLQIIAKEFGKKGIYE*
Ga0119789_10229723300011925Human OralMKKLLFKLFFALAFVSISLHGQEKIQQVEFSSFGGRAVYSSRYTLNSLKKEFSAKPLMGQKEELPKEISLPNTPKNWEAFTKKINLNKFKELKDGPSEQAADGQDKVIIIKTNKKTYRKMNASGNDHDRETWYDLLQIIAKEFGKKSIYE*
Ga0119789_10229743300011925Human OralMKKLLFKLFFALAFTSISLHGQEKIQQVEVHIFGGMALYSSHYTINFLYKEFEAKQVMGEPAELPKKILLLNPPDKWRVFTKKINLDKFKKLRDGPSEQAFDGQDEVIIIKTDKKTYRKMNASGNDHDREVWYDLLQIIAKEFGKKGIYE*
Ga0119789_11307523300011925Human OralMKKLLFKLFFALAFASISLHGQEKIQQVEVHIFGGMALYSSQYTLNSLKKEFNTKPLMGQKEELPKEISLPNTPKNWEAFTKKINLDKFKKLRDGPSQQAFDGQDEVIIIKTDKKTYRKMNASGNDHDRKVWYDLLQIIAKEFGKKGVYE*
Ga0119808_10580523300011928Human OralMKKLLFKLFFALAFTSISLHGQEKIQQVEFSSFGGMALYSSRYTLNSLKKEFSAKPLMGQNEDLPKEISLPNTPKNWEAFTKKINLNKFKKLRDGPSQQAFDEHDEVIIIKTDKKTYRKMNTSGNDHDREVWYDLLKIIAKEFGKKSIYE*
Ga0119794_103555713300011970Human OralMKKLLFKLFFALAFTSISLHGQERIQQVEFSSFGGMALYSRQYTLNSLKKEFSKKLLMRQNKDLPEEISLPNTPENWEAFTKKINLNKFKKLRDGPSEQAFGGQDKVIIIKTDKKTYRKMNAYGNDHDMETWYDLLQIIAEEFEKI*
Ga0119788_100607853300011972Human OralMKKLLFKLFFALAFTSISLHGQEKIQQVEFSSFGGRALYSRLYTLNSLKKEFNTKPLMGQKEELSKEVSLPNTPKNWEVFIKKINLDKFKKLRDGPSEQAFGGQDKVIIIKTNKKTYRKMNAYGNDHDRETWYDLLQIIAEEFEKI*
Ga0119778_106550813300011981Human OralFKLFFALAFVSISLHGQEKIQQVEVHIFGGRALYSSRYTLNSLKKEFNTKPLMGQKEELPKEISLPNTPKNWETFTKKINLDKFKELKDGPSEQAADGQDKVIIIKTNKKTYRKMNASGNDHDRETWYDLLQIIAKEFGKKSIYE*
Ga0119799_12871923300013749Human OralFALSFASISLHGQEKIQQVEVHIFGGMALYSRQCTLNSLKKEFNTKVLLRQNEELPKEISLPNTPKNWEVFIKKINLDKFKELKDGPSEQASDGQDKIIIIKTDKKTYRKMNASGNDHDREVWYDLLQIIAKEFGKKGIYE*
Ga0119802_104378213300013751Human OralMKKLLFKLFFALTLTSISLHGQEKIQQVEVHIFGGMALYSSHYTINFLYKEFEAKQVMGEPAELPKKILQLNPPDKWRVFTKKINLDKFKKLRDGPSEQAVDGQDEVIIIKTDKKTYRKMNAYGNDHDREVWYDLLQIIAKEFGKKGIYE*
Ga0119801_11354033300014024Human OralISLHGQEKIQQVEVHIFGGMALYSSHYTINFLYKEFEAKQVMGEPAELPKKILQLNPPDKWRVFTKKINLDKFKKLRDGPSQQAFDGQDKVIIIKTDKNTYRKMNAYGNDHDREVWYDLLQIIAKEFGKKSIYE*
SRS013164_Baylor_scaffold_42233__gene_545437000000039HumanMKKLLFKLFFTLAFASISLHGQEKIQQVEFSSFGGMALYSSRYTLNSLKKEFSAKPLMGQNEDLPKEISLPNTPKNWEAFTKKINLDKFKKLRDGPSQQAFDGQDEVIIIKTDKKTYRKMNASGNDHDRKVWYDLLQIIAKEFGKKSIYE
C3039953__gene_904987000000061HumanRIQTAFIMKKLLFKLFFALAFASISLHGQEKIQQVEVHIFGGMALYSSQYTLNSLKKEFSAKPLMGQKEELPKEISLPNTPKNWETFTKKINLDKFKKLRDGPSQQAFDGQDEVIIIKTDKKTYRKMNASGNDHDRKVWYDLLQIIAKEFGKKSIYE
SRS018145_Baylor_scaffold_36207__gene_495407000000085HumanLAFASISLHGQEKIQQVEVHIFGGMALYSSQYTLNSLKKEFSAKPLMGQKEELPKEISLPNTPKNWEAFTKKINLDKFKKLRDGPSQQAFDGQDEVIIIKTDKKTYRKMNASGNDHDRKVWYDLLQIIAKEFGKKSIYE
SRS023964_Baylor_scaffold_63463__gene_819597000000119HumanMKKLLFKLFFALAFASISLHGQEKIQQVEVHIFGGMALYSSHYTINSLKKEFSAKPLMGQNEDLPKEISLPNTPKNWEAFTKKINLDKFKKLRDGPSQQAFDGQDEVIIIKTNKKTYRKMNAFGNDHDRETWYDLLQIIAKEFGKKSIYE
C2511816__gene_1689337000000156HumanMKKLLFKLFFALAFVSISLHGQEKIQQVEFNSFGGMALYSSQYTLNSLKKEFSAKPLMGQKEELPKEISLPNTPKNWEAFTKKINLDKFKKLRDGPSQQAFDGQDEVIIIKTDKKTYRKMNASGNDHDRKVWYDLLQIIAKEFGKKGIYE
SRS022077_Baylor_scaffold_56510__gene_831037000000194HumanMKKLLFKLFFALAFASISLHGQEKIQQVEVHIFGGMALYSSQYTLNSLKKEFSAKPLMGQKEELPKEISLPNTPKNWETFTKKINLDKFKKLRDGPSQQTFDGQDEVIIIKTDKKTYRKMNASGNDHDREVWYDLLQIIAKEFGKKSIYE
SRS017209_Baylor_scaffold_59150__gene_826557000000195HumanMKKLLFKLFFTLAFASISLHGQEKIQQVEVHIFGGMALYSSQYTLNSLKKEFSAKPLMGQKEELPKEISLPNTPKNWEAFTKKINLDKFKKLRDGPSQQAFDGQDEVIIIKTDKKTYRKMNASGNDHDRKVWYDLLQIIAKEFGKKSIYE
C3664095__gene_2354537000000240HumanMKKLLFKLFFTLAFASISLHGQEKIQQVEFSSFGGMALYSSQYTLNSLKKEFSAKPLMGQKEDLPKEISLPNTPKNWEAFTKKINLDKFKKLKDGPSEQAFDGQDEVIIIKTDKKTYRKMNASGNDHDREVWYDLLQIIAKEFGKKGVYE
C2656674__gene_2116877000000286HumanMKKLLFKLFFALAFASISLHGQEKIQQVEFSSFGGMALYSSQYTLNSLKKEFSAKPLMGQKEELPKEISLPNTPKNWEAFTKKINLDKFKKLRDGPSQQAFDGQDEVIIIKTDKKTYRKMNASGNDHDRKVWYDLLQIIAKEFGKKSIYE
C3109720__gene_1271627000000324HumanMKKLLFKLFFALAFTSISLHGQEKIQQVEVHIFGGMALYSSQYTLNSLKKEFNTKPLMGQKEELPKEISLPNTPKNWEAFTKKINLDKFKKLRDGPSQQAFDGQDEVIIIKTDKKTYRKMNASGNDHDREAWYNLLQIIAKEFGKKSIYE
SRS015985_WUGC_scaffold_31175__gene_442567000000354HumanQVEVHIFGGMALYSSHYTINFLYKEFEAKQVMGEPAELPKKILLLNPPDKWRVFTKKINLDKFKKLRDGASEQAFDGQDEVIIIKTDKKTYRKMNASGNDHDREVWYDLLQIIAKEFGKKGIYE
C1522394__gene_960447000000446HumanKKLLFKLFFTLAFASISLHGQEKIQQVEVHIFGGMALYSSQYTLNSLKKEFSAKPLMGQKEELPKEISLPNTPKNWEAFTKKINLDKFKKLRDGPSQQAFDGQDEVIIIKTDKKTYRKMNASGNDHDRKVWYDLLQIIAKEFGKKSIYE
SRS057692_LANL_scaffold_27373__gene_335317000000496HumanMKKLLFKLFFTLAFASISLHGQEKIQQVEVHIFGGMALYSSQYTLNSLKKEFSAKPLMGQKEELPKEISLPNTPKNWEAFTKKINLDKFKKLRDGPSQQAFDGQDKVIIIKTDKKTYRKMNASGNDHDRKVWYDLLQIIAKEFGKKSIYE
SRS019022_WUGC_scaffold_61976__gene_723047000000599HumanMKKLLFKLFFALAFASISLHGQEKIQQVEFNSFGGMALYSSQYTLNSLKKEFSAKPLMGQKEELPKEISLPNTPKNWETFTKKINLNKFKKLRDGPSEQAFGGQDKVIIIKTNKKTYRKMNASGNDHDREVWYDLLQIIAEEFGKKGVYE
C1523969__gene_545877000000638HumanKKLLFKLFFALAFASISLHGQEKIQQVEFNSFGGMALYSSQYTLNSLKKEFSAKPLMGQNEDLPKEISLPNTPKNWEAFTKKINLNKFKKLREGPSQQAFDGQDEVIIIKTDKKTYRKMNASGNDHDREVWYDLLKIIAKEFGKKGIYE
SRS049389_WUGC_scaffold_43348__gene_533117000000677HumanMKKLLFKLFFALAFVSISLHGQEKIQQVEVHIFGGMALYSSRYTLNSLKKEFSAKPLMGQKEELPKEISLPNTPKNWEAFTKKINLDKFKKLRDGPSQQTFDGQDEVIIIKTDKKTYRKMNASGNDHDRKVWYDLLQIIAKEFGKKSIYE


 ⦗Top⦘


© Pavlopoulos Lab, Bioinformatics & Integrative Biology | B.S.R.C. "Alexander Fleming" | Privacy Notice
Make sure JavaScript is enabled in your browser settings to achieve functionality.